Clone AT01767 Report

Search the DGRC for AT01767

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:17
Well:67
Vector:pOTB7
Associated Gene/TranscriptCG6479-RB
Protein status:AT01767.pep: gold
Sequenced Size:1816

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6479-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

AT01767.complete Sequence

1816 bp assembled on 2009-09-21

GenBank Submission: BT099772.1

> AT01767.complete
TAGAATTCAGAAAATTAACCCATGAATGCTCCTCAGCTCGCCGCTGAGTA
AAAACCCAGTGGTGCAGCGCAGCCTGGACTTGCGATTGCAGGGCGCCCAA
GCGCGGCATTACCTCAAGTGGTGCTCCATAAATGTGGTGCTGCTGTCGCT
ACTCCTCTTCGACCTCTGGCAGGCATGTCGGTCCGCCTACAGGACCTACT
GGTTCCTGGCGGAGTGCACCATTACGACCCTGATTGGCCTAAGTGCACTC
GCCTGCTTCGGCAAGTATTTGTGGTTATGGTTTGGTGGTGACCAAGTTAC
GGGTAGCGATATCCAAAAGTGGCTGCTTGATGGCAAGGCAGAGAACTCTT
TTCGTACAGTTTGCTCCCGAGCCGTGATGAAACCACGCAGCTACGAACCG
GATAGCGATATAGAGGACGACATACCCATCATCAACTGGCACTCCTCCTT
CGAGGACTCCTGCTGGGGCTCGCAATCCATGCGCCGCAGCCCCAGTCCCA
CAAGGACGCCGCAGCAGACGAAACAAAACACCTCTTACAACTCCTCGATG
GTTCGAAACAACTCGCTGAATGCCAGCAATCTGAGCAACGAGTCTACCTA
TATGTCCCCGTATGCGGAGGTGCGACGCGATGACTTCATGACCGATACAC
GAAAGTTGACCAGTCTAATGAAGCAGGCGGATCGGGAGCGCAGCATGATG
GACAGCTCGGATACACCCAATGTGCAGAGCATGGGATCGGCCAACTCCTT
CTGGAATTACTGCAACAATGCGGCCTATATGCTCAAGACCACCATCTATC
AACTATCGCCACCTCCGGCTGTTTCTACGGAAAATGCTCCCACCTCGATT
GAGGAGTTTGGCGGTATTCAGTTTAGGGACAGCAATTCGGAGGTCATCAA
GCGCATATCCACGGACAAACTGTCGCAATATGTGGCCAACCTAAGATTTT
GGATTTCTACGACCATACTTCAGCGTTTGGTCAAAGAGATCAATTATGTG
GACGATGTTTTCCGCCAGCGAGCTCTGATTGACATTAAAATTGGATCTGT
GAGTGTAGAGAGATTACGCAAAACAGCCGAGAACCAGCAGTTCGTGCAGA
CGTGTGCGCCCATGTTGCCCATGCTCTTACCTTTCCTGGACACCTTCAGC
AACCAGGAATACCTGGTGCAGCGCATCAAGGAGCTTGCGCAGGGCTCTTG
CATAGCTGACTACCGCTGGTACTCGGGCAAAACACACAACGGTCAGCAGC
GGGACGAGCATTTGCCCACCGATGCAGCTATAATATTCCATTTATTTTGC
GTGTACTTGGATAGCCAGTTGATGCCGTTGCCGCAGGGCGGCGGACGACC
CTTTCACTCCCGCTACGTGTTAATTCGCGACGAGAAGAGCTCGACCAAGG
ACGTGGTGAACGCAGTTCACAACAAGGCCCACTGCGCCATTTTAAGTACC
GGCAACCCACTTAACCCTAAATTTAACTTTATCAGCGACAAAGAACTACA
CAACTGCGTCTACGATAGGAATAACCTGTTCTACGTTATCATACAGTTCC
TAATTTATATGCGACAGCACCAGGACTCTGCTCTGGAGTGCGTAAATCTT
GGCAAGAGTGGTATCAACATCATGTGCGTCATCGAAGACTGAACTGTGGA
TCTAGTCGGCCGTGGCTATGACTTTTAACCCGACCCCTAATCACTCGTTA
TTTCTAAGCATGATCCTTTGTGACTCGACTATCGTTTGGTGACTGGACAA
TCCTCATCATTCGTTACTATGAAATTATACATTTGTAATTATTAAGCCAA
AAAAAAAAAAAAAAAA

AT01767.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG6479-RB 1892 CG6479-RB 20..1812 1..1800 8735 99.1 Plus
CG6479-RA 2022 CG6479-RA 117..1874 36..1800 8560 99 Plus
CG6479.a 2004 CG6479.a 420..1856 357..1800 6955 98.8 Plus
CG6479.a 2004 CG6479.a 117..422 36..341 1530 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17327576..17328185 949..340 3035 99.8 Minus
chr3L 24539361 chr3L 17326619..17327130 1798..1280 2380 97.7 Minus
chr3L 24539361 chr3L 17328243..17328583 341..1 1705 100 Minus
chr3L 24539361 chr3L 17327190..17327519 1279..950 1650 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG6479-RB 1617 CG6479-PB 1..1617 26..1642 8055 99.9 Plus
CG6479-RA 1629 CG6479-PA 23..1629 36..1642 8005 99.9 Plus
CG6479-RC 1611 CG6479-PC 23..1611 36..1642 7700 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:37:21 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG6479-RB 1791 CG6479-RB 1..1791 1..1798 8715 99.1 Plus
CG6479-RA 1861 CG6479-RA 106..1861 36..1798 8540 99.1 Plus
CG6479-RC 1843 CG6479-RC 106..1843 36..1798 8235 98.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG6479-PB 538 CG6479-PB 1..538 26..1639 2634 100 Plus
CG6479-PA 542 CG6479-PA 9..542 38..1639 2617 100 Plus
CG6479-PC 536 CG6479-PC 9..536 38..1639 2569 98.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17338129..17338738 949..340 3035 99.8 Minus
3L 28110227 3L 17337170..17337683 1800..1280 2345 97.1 Minus
3L 28110227 3L 17338796..17339136 341..1 1705 100 Minus
3L 28110227 3L 17337743..17338072 1279..950 1650 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17331229..17331838 949..340 3035 99.8 Minus
3L 28103327 3L 17330270..17330783 1800..1280 2355 97.1 Minus
3L 28103327 3L 17331896..17332236 341..1 1705 100 Minus
3L 28103327 3L 17330843..17331172 1279..950 1650 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:13:13 has no hits.

AT01767.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:30:53 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17328243..17328583 1..341 100   Minus
chr3L 17327576..17328183 342..949 99 <- Minus
chr3L 17327190..17327519 950..1279 100 <- Minus
chr3L 17326619..17327130 1280..1798 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:43 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 1..1617 26..1642 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:31:33 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 1..1617 26..1642 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:23:28 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 1..1617 26..1642 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:30:53 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 1..1617 26..1642 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-21 15:17:15 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 1..1791 1..1798 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:31:33 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 1..1791 1..1798 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:23:28 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 1..1791 1..1798 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:30:53 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 1..1791 1..1798 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:30:53 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17338796..17339136 1..341 100   Minus
3L 17338129..17338736 342..949 99 <- Minus
3L 17337743..17338072 950..1279 100 <- Minus
3L 17337172..17337683 1280..1798 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:23:28 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17331896..17332236 1..341 100   Minus
arm_3L 17331229..17331836 342..949 99 <- Minus
arm_3L 17330843..17331172 950..1279 100 <- Minus
arm_3L 17330272..17330783 1280..1798 97 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:21 Download gff for AT01767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17331896..17332236 1..341 100   Minus
3L 17331229..17331836 342..949 99 <- Minus
3L 17330843..17331172 950..1279 100 <- Minus
3L 17330272..17330783 1280..1798 97 <- Minus

AT01767.pep Sequence

Translation from 25 to 1641

> AT01767.pep
MLLSSPLSKNPVVQRSLDLRLQGAQARHYLKWCSINVVLLSLLLFDLWQA
CRSAYRTYWFLAECTITTLIGLSALACFGKYLWLWFGGDQVTGSDIQKWL
LDGKAENSFRTVCSRAVMKPRSYEPDSDIEDDIPIINWHSSFEDSCWGSQ
SMRRSPSPTRTPQQTKQNTSYNSSMVRNNSLNASNLSNESTYMSPYAEVR
RDDFMTDTRKLTSLMKQADRERSMMDSSDTPNVQSMGSANSFWNYCNNAA
YMLKTTIYQLSPPPAVSTENAPTSIEEFGGIQFRDSNSEVIKRISTDKLS
QYVANLRFWISTTILQRLVKEINYVDDVFRQRALIDIKIGSVSVERLRKT
AENQQFVQTCAPMLPMLLPFLDTFSNQEYLVQRIKELAQGSCIADYRWYS
GKTHNGQQRDEHLPTDAAIIFHLFCVYLDSQLMPLPQGGGRPFHSRYVLI
RDEKSSTKDVVNAVHNKAHCAILSTGNPLNPKFNFISDKELHNCVYDRNN
LFYVIIQFLIYMRQHQDSALECVNLGKSGINIMCVIED*

AT01767.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24321-PA 545 GF24321-PA 9..545 5..538 2377 83.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15823-PA 542 GG15823-PA 9..542 5..538 2744 94.2 Plus
Dere\GG15122-PA 402 GG15122-PA 140..392 278..538 723 57.4 Plus
Dere\GG15122-PA 402 GG15122-PA 9..139 5..142 263 48.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14916-PA 931 GH14916-PA 373..931 3..538 1805 66.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG6479-PB 538 CG6479-PB 1..538 1..538 2840 100 Plus
CG6479-PA 542 CG6479-PA 9..542 5..538 2823 100 Plus
CG6479-PC 536 CG6479-PC 9..536 5..538 2775 98.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12895-PA 608 GI12895-PA 44..608 13..538 1760 60.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15495-PA 535 GL15495-PA 10..535 11..538 2162 75.5 Plus
Dper\GL19039-PA 472 GL19039-PA 9..472 10..538 1068 48.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23842-PA 535 GA23842-PA 10..535 11..538 2157 75.5 Plus
Dpse\GA25319-PA 500 GA25319-PA 9..500 10..538 1192 51.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24343-PA 542 GM24343-PA 9..542 5..538 2693 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12417-PA 515 GD12417-PA 9..515 5..538 2517 92.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13037-PA 550 GJ13037-PA 17..550 24..538 1847 68.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20346-PA 539 GK20346-PA 9..539 5..538 2054 71.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22163-PA 542 GE22163-PA 9..542 5..538 2743 94.4 Plus
Dyak\GE21349-PA 204 GE21349-PA 2..188 347..536 540 55.7 Plus

AT01767.hyp Sequence

Translation from 25 to 1641

> AT01767.hyp
MLLSSPLSKNPVVQRSLDLRLQGAQARHYLKWCSINVVLLSLLLFDLWQA
CRSAYRTYWFLAECTITTLIGLSALACFGKYLWLWFGGDQVTGSDIQKWL
LDGKAENSFRTVCSRAVMKPRSYEPDSDIEDDIPIINWHSSFEDSCWGSQ
SMRRSPSPTRTPQQTKQNTSYNSSMVRNNSLNASNLSNESTYMSPYAEVR
RDDFMTDTRKLTSLMKQADRERSMMDSSDTPNVQSMGSANSFWNYCNNAA
YMLKTTIYQLSPPPAVSTENAPTSIEEFGGIQFRDSNSEVIKRISTDKLS
QYVANLRFWISTTILQRLVKEINYVDDVFRQRALIDIKIGSVSVERLRKT
AENQQFVQTCAPMLPMLLPFLDTFSNQEYLVQRIKELAQGSCIADYRWYS
GKTHNGQQRDEHLPTDAAIIFHLFCVYLDSQLMPLPQGGGRPFHSRYVLI
RDEKSSTKDVVNAVHNKAHCAILSTGNPLNPKFNFISDKELHNCVYDRNN
LFYVIIQFLIYMRQHQDSALECVNLGKSGINIMCVIED*

AT01767.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6479-PB 538 CG6479-PB 1..538 1..538 2840 100 Plus
CG6479-PA 542 CG6479-PA 9..542 5..538 2823 100 Plus
CG6479-PC 536 CG6479-PC 9..536 5..538 2775 98.9 Plus