Clone AT02619 Report

Search the DGRC for AT02619

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:26
Well:19
Vector:pOTB7
Associated Gene/Transcriptqua-RB
Protein status:AT02619.pep: gold
Sequenced Size:3140

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
qua-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

AT02619.complete Sequence

3140 bp assembled on 2009-11-02

GenBank Submission: BT100209.1

> AT02619.complete
TTTTGGGATATCAACACCCCCATTCAAAATTTTTTTCGAATTTTATGTAT
CGTGATTTTTTGAGCGAACCGATCGCTCTCAAAACGCTGCTGCGTGTGTG
TTTTTGAAGTGAGTGTGCGGCAGCGACATTCGCTTTTCAAAAGCGCTGGC
AAAACGAAAACTCGCAAGGATTTCACTTTGAGCTGCGCTGCTGCCGGCTT
CCATCGGAATTGCCATCGGTTTTGTGGGGAGGGGGAGACAAATCAAAACT
AGTTCAAGGCAGCTGTGCTGTATCTTTCAGATACAGATACATCCGCGCAC
ATGGAGCTATCGCTGTCACCAAAAGAAACGGAGATCCGTCCCAACACCAT
TCCGGACTTAAAGGTGGATGCCACATTTCGGAAGGTGGCTAAACATGCGA
TTACCTTTGCGATTTGGAAGATAGACGAGGATCGCCTGGAGGCGGTACAA
AGATCACATTATGGCACCTTCTACGATAGCTGCGCCTACATTATCTATGC
AGCAAGTTTGTCGGGGCATTATGCCAATCACGAAACCATCACACGCGAAC
AGAAGCCGAATGTGAGTCTTGAGCGATATATCCACTACTGGCTGGGCAAG
AATGTTAGCGAGCAGAATCGATCCAATGTTGTTCATAAAATCCAGGAGCT
GGACTCGTATCTGGGAAACATATCCTCTATTTACCGAGAGACCCAGAATC
TGGAGAGTGCGAGATTCCTTTCGTATTTCAAGAAGGGTTACGATGTTCGA
TCGGGAGCACTAATAAGCGCGCCCCAGAGGCCACGACTTTTTCAATTGTA
CGCCCGCAAATGGTTGCGATCCATTGAGGTGGCCACCATCGATTGGTCGC
ACTTTAACTCGGATTACGTAATGGTCCTGCAAACGGATAATCTTACCTAC
GTCTGGATAGGGCGCTCCAGTTCAGGAATTGAACGACGAAGTGCCCTCGA
CTGGGTCCAAAAGCACTGCAGTGGATCGCCAATCACTATAGTCGATGATG
GATATGAGCAGGCCATGTCCCAGGAGCACAAGGAGCTGTGGAACACCATG
CTTCCGCTAAAGAAACGCATGGTCTGTCAGGCCAGTCAGTTGGTCAGCGA
ATACGCCGACTACAATAGCAATAAGTTCCGCATCTATAAGTGCAATCAAC
GGGGAAGGCTGCACCTGGATCAATTGGATGTGGGCATGCCAGCAAAAGAT
GATCTAAGCGATGCCCATGGAGTCTATTTACTGGACAACTACGGCCAGAG
TATTTGGTTGTGGGTAGGAGGCCAGGCACCGCAGGCAGATGCCCTTTCTG
CCATGGGAAATGGGAGAGCTTTTGTTAAAAAGAAGAAATATCCGGATAAT
ACGTTGGTGGTGCGTGTCCTCGAGGGTCACGAGCCCGTGGAGTTTAAGCG
TCTCTTTGCCAACTGGTTAAATGTTTGGCAGGAGAACACCAGGGGACATA
AGCCAGTGTCCACAAAGTTTGGAAAGCTAGATGCCCATTCCCTATGCGAA
CGCCCTAAAATGGCTGCAGATACACAGCTCGTTGATGATGGCAGGGGTGA
AAGAGTAATCTATCGTGTCTTCGGAGATCAGGTGCAAGAGGTGCCCATCT
CAAAAACGGTTGTGTTCACCACCAATGCCAGTTTCGTGGTCAAGTACAGC
GTGCAGTGCGCCACCGTTGTTCCCGCAGATTTGGCCTCCGTTGGCATTAA
AACAATCATCTACCAGTGGAATGGTTCGGAGGCCTCTGTAGAGTCCATTT
CCCGGGCGGACAAGTTCGCCAAGGCCAGTTTTGATGGGCTCAAGGAGCCT
GGAATGTTTGTACAGCTCTATGAGTTCGATGAACCACCGCACTTCCTTCA
GATCTTCGAGGGAAAACTTATTATCAGGCGCGGTCAGCGTACCGAGATGC
CTTACAATGGTAACTCCAATGCCTTGCTGGACACCTTTCTGCTGAAAGTT
TATGGCGATGCTAGCTACAATGCCAAGGCTGTGGAGGAGACACATCTGTC
ATCGATCAGCTCCAAAGATTGCTATGTGATCAAAACGAATCATGTTTGGG
TGTGGTGCGGGCAAAGTAGCACGGGAGATGCCCGCGAGATGGCCAAAGCA
GTGGGAGCTCTGATGGGGGAAAACTCTCTGGTCCTCGAAGGCAAGGAAAG
TAAGGAGTTCTGGCAATCGGTGGCCATGTACTTCAACCAAACTCTAGTGA
TCAACGGAAATGGGAACTCATGTTCCAGCAGCACCAGTAGCAGCAGTGGC
GCCGGCAGCATGTGCAATGGTAGCTCCAATGGTGGTAACATTTCACCCAC
TCTCAGCAATAATTGTTACCTAAACACCAGTGTTCCGAGTAAACCGAGAC
CTCCTGTACAACTATTTCTGGTATGGTGGCAACAGAGTTCGCTGAGATAC
GAGGAGATTCTCGGATTCGATCAGCAGGATCTCAGTTCGGATTGCACCTA
TATTCTGGACACTGGGAGCCTCACCTACGTCTGGCTGGGATCGCAGGCCC
CAAACCAGGAACGCTACACAGCGATTGCCCAAAGTTATGTCCAAAATGCT
CCATTCGGACGCAGATCAGCGACAGCGTTGGCCGTGGTCAGGCAGTTTCA
GGAGCCAAATGTTTTCAAGGGATTCTTCGAGTCCTGGCAAAACGATTACG
GCAAGAACTTCCATTCCTACGAGAAAATGCGCAAGGATCTGGGAAATAAA
GTGACCAGCAATTGTTGCTTCGCAAGCGAAGGATCGGCTCTAATCCTGAA
CAACAGACAGAAGGACTTTGATGGTCACAAAAAGTATCCATTAACCGTGC
TCATCCAGGAAATGGATATGCTGCCACCAGATATTAATCCGCTCAAGAGG
GAGGTTCACCTAACACACGATGATTTTGTGTCAGTGTTTAATATGTCCTT
TTATGAATTTGACGAGCTGCCGAAATGGAAGAAAATGGAGCTGAAAAAGC
AATTCAAGCTTTTTTAGATTATAAACATGTTGAAATGCGTGTAACGAGTG
CGCACTGTACATATCCTCAATTGCAACACAATGAATACTATGAAGAGGTA
GTAACTGTTGAAGCAATTTATGTTAAACATACACATTTTACGTAGATATA
ATAAAGCAAAAACATGAAATATAAAAAAAAAAAAAAAAAA

AT02619.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
qua-RB 3349 qua-RB 227..3349 1..3123 15615 100 Plus
qua-RA 3356 qua-RA 542..3337 330..3125 13980 100 Plus
qua.b 3251 qua.b 934..2459 744..2269 7630 100 Plus
qua.b 3251 qua.b 2459..3251 2330..3122 3965 100 Plus
qua.b 3251 qua.b 179..921 1..743 3715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17486009..17487010 2655..1654 4980 99.8 Minus
chr2L 23010047 chr2L 17487064..17487976 1656..744 4550 99.9 Minus
chr2L 23010047 chr2L 17490422..17490751 331..1 1575 99.1 Minus
chr2L 23010047 chr2L 17485413..17485683 3122..2852 1355 100 Minus
chr2L 23010047 chr2L 17488300..17488510 540..330 1055 100 Minus
chr2L 23010047 chr2L 17488038..17488240 743..541 1015 100 Minus
chr2L 23010047 chr2L 17485745..17485946 2855..2654 1010 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:55:45
Subject Length Description Subject Range Query Range Score Percent Strand
qua-RB 2667 CG6433-PB 1..2667 301..2967 13335 100 Plus
qua-RA 2664 CG6433-PA 27..2664 330..2967 13190 100 Plus
qua-RC 2679 CG6433-PC 1..2679 301..2967 13180 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:38:14 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
qua-RB 3306 CG6433-RB 185..3306 1..3122 15610 100 Plus
qua-RC 3318 CG6433-RC 185..3318 1..3122 15455 99.6 Plus
qua-RA 3266 CG6433-RA 474..3266 330..3122 13965 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
qua-PB 888 CG6433-PB 1..888 301..2964 4438 100 Plus
qua-PC 892 CG6433-PC 1..892 301..2964 4419 99.4 Plus
qua-PA 887 CG6433-PA 10..887 331..2964 4390 100 Plus
Gel-PL 740 CG1106-PL 16..740 412..2703 419 24.6 Plus
Gel-PA 740 CG1106-PA 16..740 412..2703 419 24.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17487402..17488403 2655..1654 5010 100 Minus
2L 23513712 2L 17488457..17489369 1656..744 4565 100 Minus
2L 23513712 2L 17491801..17492131 331..1 1655 100 Minus
2L 23513712 2L 17486803..17487076 3125..2852 1370 100 Minus
2L 23513712 2L 17489693..17489903 540..330 1055 100 Minus
2L 23513712 2L 17489431..17489633 743..541 1015 100 Minus
2L 23513712 2L 17487138..17487339 2855..2654 1010 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17487402..17488403 2655..1654 5010 100 Minus
2L 23513712 2L 17488457..17489369 1656..744 4565 100 Minus
2L 23513712 2L 17491801..17492131 331..1 1655 100 Minus
2L 23513712 2L 17486803..17487076 3125..2852 1370 100 Minus
2L 23513712 2L 17489693..17489903 540..330 1055 100 Minus
2L 23513712 2L 17489431..17489633 743..541 1015 100 Minus
2L 23513712 2L 17487138..17487339 2855..2654 1010 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:55:42 has no hits.

AT02619.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:43:47 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17490423..17490751 1..330 99   Minus
chr2L 17488300..17488509 331..540 100 <- Minus
chr2L 17488038..17488240 541..743 100 <- Minus
chr2L 17487064..17487976 744..1656 99 <- Minus
chr2L 17486009..17487007 1657..2655 99 <- Minus
chr2L 17485747..17485944 2656..2853 100 <- Minus
chr2L 17485413..17485681 2854..3122 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-02 09:36:32 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 1..2667 301..2967 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:15:49 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 1..2667 301..2967 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:32 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 1..2667 301..2967 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:43:47 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 1..2667 301..2967 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-02 09:36:31 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 179..3300 1..3122 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:15:49 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 179..3300 1..3122 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:32 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 185..3306 1..3122 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:43:47 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 185..3306 1..3122 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:43:47 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17491802..17492131 1..330 100   Minus
2L 17489693..17489902 331..540 100 <- Minus
2L 17489431..17489633 541..743 100 <- Minus
2L 17488457..17489369 744..1656 100 <- Minus
2L 17487402..17488400 1657..2655 100 <- Minus
2L 17487140..17487337 2656..2853 100 <- Minus
2L 17486806..17487074 2854..3122 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:32 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17491802..17492131 1..330 100   Minus
arm_2L 17489693..17489902 331..540 100 <- Minus
arm_2L 17489431..17489633 541..743 100 <- Minus
arm_2L 17488457..17489369 744..1656 100 <- Minus
arm_2L 17487402..17488400 1657..2655 100 <- Minus
arm_2L 17487140..17487337 2656..2853 100 <- Minus
arm_2L 17486806..17487074 2854..3122 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:05:44 Download gff for AT02619.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17491802..17492131 1..330 100   Minus
2L 17489693..17489902 331..540 100 <- Minus
2L 17489431..17489633 541..743 100 <- Minus
2L 17488457..17489369 744..1656 100 <- Minus
2L 17487402..17488400 1657..2655 100 <- Minus
2L 17487140..17487337 2656..2853 100 <- Minus
2L 17486806..17487074 2854..3122 100 <- Minus

AT02619.pep Sequence

Translation from 300 to 2966

> AT02619.pep
MELSLSPKETEIRPNTIPDLKVDATFRKVAKHAITFAIWKIDEDRLEAVQ
RSHYGTFYDSCAYIIYAASLSGHYANHETITREQKPNVSLERYIHYWLGK
NVSEQNRSNVVHKIQELDSYLGNISSIYRETQNLESARFLSYFKKGYDVR
SGALISAPQRPRLFQLYARKWLRSIEVATIDWSHFNSDYVMVLQTDNLTY
VWIGRSSSGIERRSALDWVQKHCSGSPITIVDDGYEQAMSQEHKELWNTM
LPLKKRMVCQASQLVSEYADYNSNKFRIYKCNQRGRLHLDQLDVGMPAKD
DLSDAHGVYLLDNYGQSIWLWVGGQAPQADALSAMGNGRAFVKKKKYPDN
TLVVRVLEGHEPVEFKRLFANWLNVWQENTRGHKPVSTKFGKLDAHSLCE
RPKMAADTQLVDDGRGERVIYRVFGDQVQEVPISKTVVFTTNASFVVKYS
VQCATVVPADLASVGIKTIIYQWNGSEASVESISRADKFAKASFDGLKEP
GMFVQLYEFDEPPHFLQIFEGKLIIRRGQRTEMPYNGNSNALLDTFLLKV
YGDASYNAKAVEETHLSSISSKDCYVIKTNHVWVWCGQSSTGDAREMAKA
VGALMGENSLVLEGKESKEFWQSVAMYFNQTLVINGNGNSCSSSTSSSSG
AGSMCNGSSNGGNISPTLSNNCYLNTSVPSKPRPPVQLFLVWWQQSSLRY
EEILGFDQQDLSSDCTYILDTGSLTYVWLGSQAPNQERYTAIAQSYVQNA
PFGRRSATALAVVRQFQEPNVFKGFFESWQNDYGKNFHSYEKMRKDLGNK
VTSNCCFASEGSALILNNRQKDFDGHKKYPLTVLIQEMDMLPPDINPLKR
EVHLTHDDFVSVFNMSFYEFDELPKWKKMELKKQFKLF*

AT02619.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15098-PA 890 GF15098-PA 10..890 11..888 4201 87.7 Plus
Dana\GF18195-PA 800 GF18195-PA 66..800 30..801 459 24.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21739-PA 887 GG21739-PA 10..887 11..888 4484 95.4 Plus
Dere\GG12208-PA 798 GG12208-PA 74..798 38..801 430 24 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10154-PA 924 GH10154-PA 10..924 11..888 3658 75.4 Plus
Dgri\GH19024-PA 802 GH19024-PA 76..802 38..801 483 24.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
qua-PB 888 CG6433-PB 1..888 1..888 4699 100 Plus
qua-PC 892 CG6433-PC 1..892 1..888 4680 99.4 Plus
qua-PA 887 CG6433-PA 10..887 11..888 4651 100 Plus
Gel-PL 740 CG1106-PL 16..740 38..801 465 24.8 Plus
Gel-PA 740 CG1106-PA 16..740 38..801 465 24.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22399-PA 897 GI22399-PA 10..897 11..888 3628 76.6 Plus
Dmoj\GI10844-PA 802 GI10844-PA 68..802 30..801 461 23.9 Plus
Dmoj\GI14741-PA 1253 GI14741-PA 482..1246 18..779 201 20 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15950-PA 887 GL15950-PA 10..887 11..888 3885 81.4 Plus
Dper\GL12306-PA 800 GL12306-PA 74..800 38..801 450 24.3 Plus
Dper\GL19818-PA 1242 GL19818-PA 461..824 18..387 176 22.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19589-PA 895 GA19589-PA 10..895 11..888 3948 82.3 Plus
Dpse\GA10732-PB 833 GA10732-PB 107..833 38..801 454 24.5 Plus
Dpse\GA10732-PA 800 GA10732-PA 74..800 38..801 452 24.5 Plus
Dpse\GA10732-PC 742 GA10732-PC 16..742 38..801 451 24.5 Plus
Dpse\GA27241-PA 1264 GA27241-PA 483..846 18..387 177 22.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17122-PA 887 GM17122-PA 10..887 11..888 4683 98.1 Plus
Dsec\GM10736-PA 789 GM10736-PA 74..789 38..801 433 24.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21863-PA 890 GD21863-PA 10..890 11..888 4577 97.6 Plus
Dsim\Gel-PA 796 GD19707-PA 74..787 38..795 423 24.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20295-PA 901 GJ20295-PA 10..901 11..888 3784 78.6 Plus
Dvir\GJ14452-PA 802 GJ14452-PA 68..795 30..797 452 24.4 Plus
Dvir\GJ19149-PA 1219 GJ19149-PA 448..1181 18..749 196 20 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18228-PA 907 GK18228-PA 1..907 1..888 3711 76.3 Plus
Dwil\GK22516-PA 792 GK22516-PA 66..792 38..801 486 24.7 Plus
Dwil\GK19942-PA 1261 GK19942-PA 481..844 18..387 183 23.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13128-PA 887 GE13128-PA 10..887 11..888 4475 95.3 Plus
Dyak\Gel-PA 798 GE25398-PA 74..798 38..801 426 24.7 Plus

AT02619.hyp Sequence

Translation from 300 to 2966

> AT02619.hyp
MELSLSPKETEIRPNTIPDLKVDATFRKVAKHAITFAIWKIDEDRLEAVQ
RSHYGTFYDSCAYIIYAASLSGHYANHETITREQKPNVSLERYIHYWLGK
NVSEQNRSNVVHKIQELDSYLGNISSIYRETQNLESARFLSYFKKGYDVR
SGALISAPQRPRLFQLYARKWLRSIEVATIDWSHFNSDYVMVLQTDNLTY
VWIGRSSSGIERRSALDWVQKHCSGSPITIVDDGYEQAMSQEHKELWNTM
LPLKKRMVCQASQLVSEYADYNSNKFRIYKCNQRGRLHLDQLDVGMPAKD
DLSDAHGVYLLDNYGQSIWLWVGGQAPQADALSAMGNGRAFVKKKKYPDN
TLVVRVLEGHEPVEFKRLFANWLNVWQENTRGHKPVSTKFGKLDAHSLCE
RPKMAADTQLVDDGRGERVIYRVFGDQVQEVPISKTVVFTTNASFVVKYS
VQCATVVPADLASVGIKTIIYQWNGSEASVESISRADKFAKASFDGLKEP
GMFVQLYEFDEPPHFLQIFEGKLIIRRGQRTEMPYNGNSNALLDTFLLKV
YGDASYNAKAVEETHLSSISSKDCYVIKTNHVWVWCGQSSTGDAREMAKA
VGALMGENSLVLEGKESKEFWQSVAMYFNQTLVINGNGNSCSSSTSSSSG
AGSMCNGSSNGGNISPTLSNNCYLNTSVPSKPRPPVQLFLVWWQQSSLRY
EEILGFDQQDLSSDCTYILDTGSLTYVWLGSQAPNQERYTAIAQSYVQNA
PFGRRSATALAVVRQFQEPNVFKGFFESWQNDYGKNFHSYEKMRKDLGNK
VTSNCCFASEGSALILNNRQKDFDGHKKYPLTVLIQEMDMLPPDINPLKR
EVHLTHDDFVSVFNMSFYEFDELPKWKKMELKKQFKLF*

AT02619.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
qua-PB 888 CG6433-PB 1..888 1..888 4699 100 Plus
qua-PC 892 CG6433-PC 1..892 1..888 4680 99.4 Plus
qua-PA 887 CG6433-PA 10..887 11..888 4651 100 Plus
Gel-PL 740 CG1106-PL 16..740 38..801 465 24.8 Plus
Gel-PA 740 CG1106-PA 16..740 38..801 465 24.8 Plus