Clone AT02852 Report

Search the DGRC for AT02852

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:28
Well:52
Vector:pOTB7
Associated Gene/TranscriptCG32495-RB
Protein status:AT02852.pep: gold
Sequenced Size:1776

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32495 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

AT02852.complete Sequence

1776 bp assembled on 2009-09-21

GenBank Submission: BT099771.1

> AT02852.complete
CCGGCGAGCAGACCCCGTGAGATACCGCGGCGAACAACTAACAACTAAGA
TACTCTGCCCCTTTTCTAGACGCAGCTGAGCCCCAGATCCCAGATCCCAG
ATACCAGCAGCAGACCGACCCAAGCAGAACGATCATGTCCAGCGACGCCA
ATACGGCCGTGCTGCGCAACTGCATCCGCTTGCCGCTGGCGGAGGATGAG
CTACTGGAGGTGACGGCCAAGGCCAAGGATTATGCCATTATGCACGGCGC
CGCCATGCGATCGAAGACGGCCTTCAGTCCGGACTCGTTGAATTTCGCCC
CCTTCGTGCTGGTGCCTTCCTCGTTTCCGCGCAAGGAGTTCGAAAAGGCG
GTGGCCCTACAGCCGATCATCAACCGGCTGATGCACAATGTGGCCCACGA
CGAGGAGTTCATCACGACGACGCTGGCGGAGACGATCAAAGTGGACGAGT
TCACGGCCAATCTGTTCAACATCTATCGCAAGGTGCTGGCGCACGGATTC
ACCCAGGCATATAGCATCGGTCTGTTGCGATCCGACTATATGGCACACGT
GTCCGAGGGCTGTGCGATAAAGCAGGTCGAGATCAACACGGTGGCCTCCA
GTTTCGCTGGCATAGCCACCCAATTGGTGCCGCAGCAGAAATTCGTACTC
AGCGAGCTGGGACATGCGGATAAGCTGCACAATATGCCGGATAACAATGC
ACTGGCCGGACTCTGCGATGGCATGGTGAAGGCGTGGGACATCTATGCAA
AGCCGCAGGCCGTCATTCTGTTCATCATCGAGGATGTGTCGTACAACATT
TGCGACCAGCGGTTCCACGAGTTCTACATTCGCGAGACATATCCGCACAT
CAAGGTGCTGCGCCGCACCCTCACCGAGGTCCATCGGGAGGGCAAACTGG
GCCAGTCCAAGGAGTTGCTCCTTGGATCCCAAGAGGTGGCCGTCATCTAC
TTCCGAGCTGGCTACGAGCCCGGACACTATCACTCGCAGGCGGATTGGGA
TGCCCGCTATCTGATGGAGACCTCGCTGGCCATCAAGTGCCCGTCGATTC
ACTACCATTTGGCGGGCACCAAGAAGGTGCAGCAGGCATTGGCGCAGCCG
GCGGTGCTCGAGCGTTTCATCAACGATCCGGAGGAGATCAAGGCGGTGGG
CAAGATCTTCACGGGTCTCTACTCGCTGGACGACAACGAGGCGGGCAATG
CCAGCTACGAGATGGCGCTGCGCACTCCGGAGAGATTCGTGCTGAAGCCG
CAGCGCGAGGGAGGCGGCAATAATGTCTACGGCGTGGATATACCAGATGC
ACTAAAGCGCATGTCACGCGTGGAGCGCTCCGCCTGGATTCTGATGGATC
TGATTCATCCGCCGCTGACCAAGGGCTATATGGTGCGGCCCGGTGGCGAT
ATGCCGCCCCAGATCGTGGACATGGTCTCCGAGCTGGGCATCTTCGGTGT
GGTGATCGGAGATGCGGAGCACATTGTGCACAACTACCAGGCGGGACACA
TGCTGCGCACAAAGCTCTCAACCGCCAACGAAGGAGGCGTGGCAGCCGGT
CTGGGCGCCCTGGACAGTCCATATCTGATCGATAGCGATGACGAGGATGA
GCAGAAGTAGGATCCTTTAACGAGATAAAGGCTTCGAACGCCGGCATTCC
ACCTGTTGCCTCAGTCTTGTATAAATGATTATTTTTGTAAAGCGTATTGT
AAATTTTTTGCACTATTTTTTCCCCGTCCCAATGTCAATAAATAAAATGT
TAAACTAGAAAAAAAAAAAAAAAAAA

AT02852.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG32495-RB 1789 CG32495-RB 32..1789 1..1758 8790 100 Plus
GS-RJ 1789 GS-RJ 32..1789 1..1758 8790 100 Plus
CG32495-RG 1940 CG32495-RG 249..1940 69..1760 8460 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17787501..17787953 1306..1758 2265 100 Plus
chrX 22417052 chrX 17794923..17795375 1306..1758 2250 99.8 Plus
chrX 22417052 chrX 17787041..17787425 923..1307 1925 100 Plus
chrX 22417052 chrX 17794463..17794847 923..1307 1925 100 Plus
chrX 22417052 chrX 17779207..17779499 1..293 1465 100 Plus
chrX 22417052 chrX 17789362..17789654 1..293 1465 100 Plus
chrX 22417052 chrX 17786726..17786964 684..922 1195 100 Plus
chrX 22417052 chrX 17794148..17794386 684..922 1195 100 Plus
chrX 22417052 chrX 17779811..17780024 294..507 1070 100 Plus
chrX 22417052 chrX 17789966..17790179 294..507 1070 100 Plus
chrX 22417052 chrX 17785875..17786011 504..640 685 100 Plus
chrX 22417052 chrX 17793295..17793431 504..640 685 100 Plus
chrU 10048995 chrU 5426436..5426572 504..640 685 100 Plus
chrU 10048995 chrU 5436775..5436911 504..640 685 100 Plus
chrX 22417052 chrX 17786538..17786580 641..683 215 100 Plus
chrX 22417052 chrX 17793960..17794002 641..683 215 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
GS-RJ 1476 CG6835-PJ 1..1476 135..1610 7380 100 Plus
GS-RE 1476 CG6835-PE 1..1476 135..1610 7380 100 Plus
CG32495-RG 1476 CG32495-PG 1..1476 135..1610 7380 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:38:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
GS-RJ 1789 CG6835-RJ 32..1789 1..1758 8790 100 Plus
CG32495-RB 1789 CG32495-RB 32..1789 1..1758 8790 100 Plus
GS-RE 1938 CG6835-RE 249..1938 69..1758 8450 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
GS-PJ 491 CG6835-PJ 1..491 135..1607 2542 100 Plus
GS-PE 491 CG6835-PE 1..491 135..1607 2542 100 Plus
CG32495-PG 491 CG32495-PG 1..491 135..1607 2542 100 Plus
CG32495-PB 491 CG32495-PB 1..491 135..1607 2542 100 Plus
GS-PI 562 CG6835-PI 214..562 561..1607 1748 95.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17898151..17898606 1306..1761 2280 100 Plus
X 23542271 X 17905573..17906028 1306..1761 2280 100 Plus
X 23542271 X 17897691..17898075 923..1307 1925 100 Plus
X 23542271 X 17905113..17905497 923..1307 1925 100 Plus
X 23542271 X 17889857..17890149 1..293 1465 100 Plus
X 23542271 X 17900012..17900304 1..293 1465 100 Plus
X 23542271 X 17897376..17897614 684..922 1195 100 Plus
X 23542271 X 17904798..17905036 684..922 1195 100 Plus
X 23542271 X 17890461..17890674 294..507 1070 100 Plus
X 23542271 X 17900616..17900829 294..507 1070 100 Plus
X 23542271 X 17896525..17896661 504..640 685 100 Plus
X 23542271 X 17903945..17904081 504..640 685 100 Plus
U 3151297 U 1396054..1396190 504..640 685 100 Plus
U 3151297 U 1406393..1406529 504..640 685 100 Plus
X 23542271 X 17897188..17897230 641..683 215 100 Plus
X 23542271 X 17904610..17904652 641..683 215 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17913671..17914126 1306..1761 2280 100 Plus
X 23527363 X 17906249..17906704 1306..1761 2280 100 Plus
X 23527363 X 17913211..17913595 923..1307 1925 100 Plus
X 23527363 X 17905789..17906173 923..1307 1925 100 Plus
X 23527363 X 17908110..17908402 1..293 1465 100 Plus
X 23527363 X 17897955..17898247 1..293 1465 100 Plus
X 23527363 X 17912896..17913134 684..922 1195 100 Plus
X 23527363 X 17905474..17905712 684..922 1195 100 Plus
X 23527363 X 17908714..17908927 294..507 1070 100 Plus
X 23527363 X 17898559..17898772 294..507 1070 100 Plus
X 23527363 X 17912043..17912179 504..640 685 100 Plus
X 23527363 X 17904623..17904759 504..640 685 100 Plus
X 23527363 X 17912708..17912750 641..683 215 100 Plus
X 23527363 X 17905286..17905328 641..683 215 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:19:34 has no hits.

AT02852.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:16:14 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17794925..17795375 1308..1758 99   Plus
chrX 17794463..17794847 923..1307 100 -> Plus
chrX 17794148..17794386 684..922 100 -> Plus
chrX 17793960..17794002 641..683 100 -> Plus
chrX 17793298..17793431 507..640 100 -> Plus
chrX 17789966..17790178 294..506 100 -> Plus
chrX 17789362..17789654 1..293 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:44 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
CG32495-RB 1..1476 135..1610 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:31:31 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RE 1..1476 135..1610 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:34:08 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RJ 1..1476 135..1610 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:16:14 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
CG32495-RG 1..1476 135..1610 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-21 15:17:16 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
CG32495-RB 1..1610 1..1610 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:31:31 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RJ 32..1789 1..1758 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:34:08 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RJ 32..1789 1..1758 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:16:14 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
CG32495-RB 32..1789 1..1758 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:16:14 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
X 17905575..17906025 1308..1758 100   Plus
X 17905113..17905497 923..1307 100 -> Plus
X 17904798..17905036 684..922 100 -> Plus
X 17904610..17904652 641..683 100 -> Plus
X 17903948..17904081 507..640 100 -> Plus
X 17900616..17900828 294..506 100 -> Plus
X 17900012..17900304 1..293 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:34:08 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17799608..17800058 1308..1758 100   Plus
arm_X 17799146..17799530 923..1307 100 -> Plus
arm_X 17798831..17799069 684..922 100 -> Plus
arm_X 17798643..17798685 641..683 100 -> Plus
arm_X 17797981..17798114 507..640 100 -> Plus
arm_X 17794649..17794861 294..506 100 -> Plus
arm_X 17794045..17794337 1..293 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:20 Download gff for AT02852.complete
Subject Subject Range Query Range Percent Splice Strand
X 17913673..17914123 1308..1758 100   Plus
X 17913211..17913595 923..1307 100 -> Plus
X 17912896..17913134 684..922 100 -> Plus
X 17912708..17912750 641..683 100 -> Plus
X 17912046..17912179 507..640 100 -> Plus
X 17908714..17908926 294..506 100 -> Plus
X 17908110..17908402 1..293 100 -> Plus

AT02852.pep Sequence

Translation from 134 to 1609

> AT02852.pep
MSSDANTAVLRNCIRLPLAEDELLEVTAKAKDYAIMHGAAMRSKTAFSPD
SLNFAPFVLVPSSFPRKEFEKAVALQPIINRLMHNVAHDEEFITTTLAET
IKVDEFTANLFNIYRKVLAHGFTQAYSIGLLRSDYMAHVSEGCAIKQVEI
NTVASSFAGIATQLVPQQKFVLSELGHADKLHNMPDNNALAGLCDGMVKA
WDIYAKPQAVILFIIEDVSYNICDQRFHEFYIRETYPHIKVLRRTLTEVH
REGKLGQSKELLLGSQEVAVIYFRAGYEPGHYHSQADWDARYLMETSLAI
KCPSIHYHLAGTKKVQQALAQPAVLERFINDPEEIKAVGKIFTGLYSLDD
NEAGNASYEMALRTPERFVLKPQREGGGNNVYGVDIPDALKRMSRVERSA
WILMDLIHPPLTKGYMVRPGGDMPPQIVDMVSELGIFGVVIGDAEHIVHN
YQAGHMLRTKLSTANEGGVAAGLGALDSPYLIDSDDEDEQK*

AT02852.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19360-PA 596 GF19360-PA 228..596 122..490 1911 94.6 Plus
Dana\GF19360-PA 596 GF19360-PA 1..141 1..143 682 90.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19140-PA 561 GG19140-PA 212..561 143..491 1776 93.4 Plus
Dere\GG19140-PA 561 GG19140-PA 1..141 1..143 679 91.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24557-PA 539 GH24557-PA 1..536 1..488 2365 83.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
GS-PJ 491 CG6835-PJ 1..491 1..491 2542 100 Plus
GS-PE 491 CG6835-PE 1..491 1..491 2542 100 Plus
CG32495-PG 491 CG32495-PG 1..491 1..491 2542 100 Plus
CG32495-PB 491 CG32495-PB 1..491 1..491 2542 100 Plus
GS-PI 562 CG6835-PI 214..562 143..491 1748 95.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16238-PA 565 GI16238-PA 199..565 122..488 1810 88 Plus
Dmoj\GI16238-PA 565 GI16238-PA 1..136 1..136 627 86.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16564-PA 486 GL16564-PA 121..486 125..490 1812 91 Plus
Dper\GL16563-PA 89 GL16563-PA 1..88 1..88 384 84.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19893-PA 614 GA19893-PA 249..614 125..490 1811 90.7 Plus
Dpse\GA19893-PA 614 GA19893-PA 1..141 1..143 650 86.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22865-PA 631 GM22865-PA 240..631 98..491 2003 94.2 Plus
Dsec\GM22865-PA 631 GM22865-PA 1..142 1..143 570 78.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17374-PA 356 GD17374-PA 1..356 136..491 1922 99.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15929-PA 568 GJ15929-PA 199..565 122..488 1838 91.6 Plus
Dvir\GJ15929-PA 568 GJ15929-PA 1..136 1..136 647 90.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16117-PA 488 GK16117-PA 1..488 1..488 2431 92 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17697-PA 491 GE17697-PA 1..491 1..491 2629 99.2 Plus

AT02852.hyp Sequence

Translation from 134 to 1609

> AT02852.hyp
MSSDANTAVLRNCIRLPLAEDELLEVTAKAKDYAIMHGAAMRSKTAFSPD
SLNFAPFVLVPSSFPRKEFEKAVALQPIINRLMHNVAHDEEFITTTLAET
IKVDEFTANLFNIYRKVLAHGFTQAYSIGLLRSDYMAHVSEGCAIKQVEI
NTVASSFAGIATQLVPQQKFVLSELGHADKLHNMPDNNALAGLCDGMVKA
WDIYAKPQAVILFIIEDVSYNICDQRFHEFYIRETYPHIKVLRRTLTEVH
REGKLGQSKELLLGSQEVAVIYFRAGYEPGHYHSQADWDARYLMETSLAI
KCPSIHYHLAGTKKVQQALAQPAVLERFINDPEEIKAVGKIFTGLYSLDD
NEAGNASYEMALRTPERFVLKPQREGGGNNVYGVDIPDALKRMSRVERSA
WILMDLIHPPLTKGYMVRPGGDMPPQIVDMVSELGIFGVVIGDAEHIVHN
YQAGHMLRTKLSTANEGGVAAGLGALDSPYLIDSDDEDEQK*

AT02852.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
GS-PJ 491 CG6835-PJ 1..491 1..491 2542 100 Plus
GS-PE 491 CG6835-PE 1..491 1..491 2542 100 Plus
CG32495-PG 491 CG32495-PG 1..491 1..491 2542 100 Plus
CG32495-PB 491 CG32495-PB 1..491 1..491 2542 100 Plus
GS-PI 562 CG6835-PI 214..562 143..491 1748 95.7 Plus