Clone AT07210 Report

Search the DGRC for AT07210

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:72
Well:10
Vector:pOTB7
Associated Gene/Transcripttoc-RC
Protein status:AT07210.pep: gold
Sequenced Size:3139

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
toc-RC 2009-06-22 Replacement based on scoring

Clone Sequence Records

AT07210.complete Sequence

3139 bp assembled on 2009-08-14

GenBank Submission: BT099598.1

> AT07210.complete
ATTTCGTACAAAAATTATAAACTTTGCCTTATTCCAATTTGAACAAATAA
ATATTGCATCCGTATTTTCATTCTTTATATCATATTTCGAATGAGACCTG
ATCCTCGGAGTGGTACAGATAATAGATAATGAAAATATGGGCTTACGTAG
GTTTATTCGCAAGCATTTTGGCAGTAAAAATTCATTGGGCAGTGCAGTTA
AAATTATAAAAAGCATAGAGAACGACGAGTTGAAAAATAAACGTTTAAAT
GGCACTTTGGCCAGCACGGCAGCAATTGCAACACCCATCAAAGGAGTGGC
CACCAAATCCGGAGCCACAAACAAGCTGCAACAATCGGCAAAAACTAAAT
CAACCGCGAGTATCAAAAGTCCAGCAATTGTCGGCGTTTCCGAGGAATCC
CTGCGCTCTGGCGTGGATCAAACCGAACTTCAGGAGCTGAACAATGGGCA
ATCTGCTACCGGTTGTCCGACGCCGCCGATGGCGCGGGACTCAAAGCGTA
CGTCCATTGGAAATGAGTTACCCTGTGAGACGGAGGCCAAGTTGAAGAGA
TGCGAGGACCAGCAGGATCCACAAGCATCCACGACGGCATCACCCCTACC
GATGATCAATCCACAGGAACAAGAAGCCAGTGGCCAGGTCAAAGAAGCAA
CAATCACCACTGCAAATGAGCCAAACGCCTTGTCCTTGCCCGACGAAATC
AGCAATTCGGTCAGCTCGACGACGATGCTGGCCACGCCCCGCGTAGACAT
AGCCGCCCAGTATCCCGTCCTGAAACCATTCACGGAGAACGGAGAGCTGG
ACTGTGCACGACTGGCCAAATTCTTCCAGGACACCCAGTTCGAGAGGAAG
GAGGAGCAACGCCAGATTCTGGGCCTCTCCGTAATGGTGCAGTTCATGTC
CAAAGAGCTGGATGCGGTTGCCTGCAAGGAGAACAAACATCAATGCGCCC
GGACCAAGGGAACGCTAGAGAAGACTATATTGCTGCTACAGCATACGCAA
AAGGATTGCGAGCGACTACGCGAGGATTTGGAGGACAAGGGCCTGGAGTG
GATTCAGCGGCAGCAGGAGAAGGAATATCTGCATCGCACTGAACTGAAGC
AAGCTGAAGAGAAATTAATGGAGGTGCAATTGCGTGCCAAGTTAAAGTTC
TGCGAATTAGAGTCCCAACTGCGTGCCAAGGACGAGGAGAGCAAACAGGC
ACAGGAGGCCTACAGAATGGAGGTCTCCCACAAACTTGCACTGAAGCAGG
AACATCTGCGCACTGCCGAGCAGAAAATCCAGGAACTGCAGACACGTCTT
CAGCAGGTGGAGACCGAGGAGCAGGGGCACCGCGAGGAGCTGATCCGCAA
GGAGAACATTCACACCGCCCGGCTGGCCGAGGCCAATCAGCGGGAGCAGG
ATCTGATCGACCGGGTCAAGAGCCTGACCAAGGAGCTGAACACCCTGAAG
GCCAACAAGGAGCATAACGAACGCGATTTGAGGGATCGGCTGGCGCTGTC
CCAGGACGAAATCTCTGTGCTGCGCACATCCTCACAGCGCCGCAGCCCCT
GCACCAGTTTGCCGGACAACGCGTCCGCCGAACTCAACCGCTTGACCAGC
GAGGCAGACAGCTTGCGCTGTGTGCTTGAGCTCAAGCAGGCGGAGATTTC
CGCCCTTAGCAAGGCCAAGGCGGATCTGATTCATGAAAGCGAGGAGCGGC
TTAAACTGAGTAACCGCGTGGCCCTTTTGGAGGCCCAAAACGAAATGCTG
CGCACCGAACTGGAGGCCAAGACCGAAAAGGAGAAGGAAATCCAGCAAAA
GATGGAGGAACTTCAGAAGGCCTACAAATACGAGAGCATTAAACGCACGC
GGCTGACGTATGACAAAGAGGAGCTACAGTACCACCTTAAGCAGAGATCA
TTGCAGCTCCAGTCGGCTGAGTCAAAGTTGCAAGATCTTTCCACTGGTTC
CCACGATAACAGCCTATCTAGCCACAGCCGATGCAGCCTGGGTCGCAGTG
GCCTGGAGATCGCCGTGACCACCTCCTCGCCCACTTCCCCAGTGATGAAG
GGAATGATTGAACGGAATGATTCCGTCAGCTGGACGCTAGAGATCGAAGA
TGAGTCGTTCAAGGGTAACACTTCAAAGATTGTGCGCAGGGCGGGGTCAC
TGCGAAGCAACAACGAGCGGTGCCCCATCCAGCGGCGACAGACATTGACA
AGCAATGGACACTCCAATGGATCGGCCACAAATGGCGGCTCTTCCCCCGC
TCATCCTAATCCCCTTAGCCAGAGCATGTCGGCCACAGCCCTTCTGAGAA
GCAGCAGTAATTCCGGGGAGTCAGAGGGTCGTCCTTTGTCCCGGGCTCGC
TCAAAATCGATGTGCATCAAAGCGTCCGCCACCAGTTCGGCGGTGTGCGA
ATCGTCTGGCCAAAGGAAGAAACCACAAGACGAGTTGAGTCTGGCCGACT
GGCCCGAGGATATTCCCCTGTGCTCCAGTTCACCACAAGCGCCGGGAATA
GAGATGCGTCCGCGCAGCTCCACCATGAAGCTAATGTCCAGCGAGGCAAA
GAAGTTCCAGGAAATCCAGGAGTCCGCCGGCGAGGCCATGGTCTCCGGTG
CTAACTCGGAGGACGAGAGCTGTTCGGCCTCATCCGAGGACATAATGCGC
AGCTCTTCCGCCTCCAGCACCGCATCGGGTGGATCCCTATCCAAGAGGCC
AAAGCAACCACCATCCCGCATGTCCATCGAGGAGGCTCTGCCCTGCACCC
CCATGGAGGTAAGCTGGTCAGAAGACGCTGCCGATGCCAACGGACTGGCA
TGACATGCTGCCTACGAGGAGCACGTCGACCAGATCGCCGAGGCGGCTGA
AGAGGCTTACGAGAGCGAGGACATTGAGGAGGATCACGATGAGCTGATCG
TGGGCGAGGAGCAGCCGGAGCACAGCGACAGCGATGATAGCTTCTAAAGC
GCTAAAACCAATTTGTAAAACAAAATAATGAGGCAGTTAGAGTCGGCACT
TGCGGCGAAGGTGGAAGTCATAGTCGGAAGCATAGCTTAGCGTTTTCACT
TCTATAGACCCCGTACATAAACTATTAAGATACACAAAAATATATAATGC
TAATTCGTACGTTCTTAACTGAAAAAAAAAAAAAAAAAA

AT07210.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
toc-RC 4178 toc-RC 1..3124 1..3124 15455 99.6 Plus
toc-RE 4807 toc-RE 866..3753 237..3124 14305 99.6 Plus
toc.c 4323 toc.c 382..3269 237..3124 14305 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3069030..3070365 3121..1786 6680 100 Minus
chr2L 23010047 chr2L 3070456..3071140 1786..1102 3425 100 Minus
chr2L 23010047 chr2L 3080627..3080902 670..395 1380 100 Minus
chr2L 23010047 chr2L 3080284..3080522 907..669 1195 100 Minus
chr2L 23010047 chr2L 3094099..3094334 236..1 1180 100 Minus
chr2L 23010047 chr2L 3071203..3071400 1103..906 990 100 Minus
chr2L 23010047 chr2L 3093855..3094013 395..237 795 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
toc-RH 2982 CG9660-PH 272..2982 237..2947 13420 99.7 Plus
toc-RC 2667 CG9660-PC 1..2667 137..2803 13200 99.7 Plus
toc-RI 2811 CG9660-PI 245..2811 237..2803 12715 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:41:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
toc-RC 3121 CG9660-RC 1..3121 1..3121 15440 99.6 Plus
toc-RI 3266 CG9660-RI 382..3266 237..3121 14290 99.7 Plus
toc-RH 4787 CG9660-RH 852..3736 237..3121 14290 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
toc-PC 888 CG9660-PC 1..880 137..2776 3980 100 Plus
toc-PH 993 CG9660-PH 91..993 236..2944 3943 99.8 Plus
toc-PI 936 CG9660-PI 74..928 209..2776 3815 99.2 Plus
toc-PE 945 CG9660-PE 91..937 236..2776 3812 99.9 Plus
toc-PD 984 CG9660-PD 130..976 236..2776 3812 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3069393..3070731 3124..1786 6665 99.9 Minus
2L 23513712 2L 3070822..3071506 1786..1102 3365 99.4 Minus
2L 23513712 2L 3080994..3081269 670..395 1380 100 Minus
2L 23513712 2L 3080651..3080889 907..669 1150 98.7 Minus
2L 23513712 2L 3094460..3094695 236..1 1150 99.2 Minus
2L 23513712 2L 3071569..3071766 1103..906 990 100 Minus
2L 23513712 2L 3094217..3094375 395..237 795 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3069393..3070731 3124..1786 6665 99.8 Minus
2L 23513712 2L 3070822..3071506 1786..1102 3365 99.4 Minus
2L 23513712 2L 3080994..3081269 670..395 1380 100 Minus
2L 23513712 2L 3080651..3080889 907..669 1150 98.7 Minus
2L 23513712 2L 3094460..3094695 236..1 1150 99.1 Minus
2L 23513712 2L 3071569..3071766 1103..906 990 100 Minus
2L 23513712 2L 3094217..3094375 395..237 795 100 Minus
Blast to na_te.dros performed 2014-11-27 11:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 569..710 204..350 122 61 Plus
Penelope 804 Penelope 804bp Derived from AF418572 (AF418572) (Rel. 70, Last updated, Version 3). 124..265 204..350 122 61 Plus

AT07210.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:23:11 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3094099..3094334 1..236 100   Minus
chr2L 3093855..3094013 237..395 100 <- Minus
chr2L 3080627..3080901 396..670 100 <- Minus
chr2L 3080284..3080520 671..907 100 <- Minus
chr2L 3071203..3071398 908..1103 100 <- Minus
chr2L 3070457..3071138 1104..1785 100 <- Minus
chr2L 3069030..3070365 1786..3121 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:12:25 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RC 1..2667 137..2803 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:59:01 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RC 1..2667 137..2803 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:55 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RH 272..2982 237..2947 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:23:11 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RH 272..2982 237..2947 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:12:25 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RC 1..3121 1..3121 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:59:01 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RC 1..3121 1..3121 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:55 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RC 1..3121 1..3121 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:23:11 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RC 1..3121 1..3121 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:23:11 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3094460..3094695 1..236 99   Minus
2L 3094217..3094375 237..395 100 <- Minus
2L 3080994..3081268 396..670 100 <- Minus
2L 3080651..3080887 671..907 98 <- Minus
2L 3071569..3071764 908..1103 100 <- Minus
2L 3070823..3071504 1104..1785 99 <- Minus
2L 3069396..3070731 1786..3121 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:55 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3094460..3094695 1..236 99   Minus
arm_2L 3094217..3094375 237..395 100 <- Minus
arm_2L 3080994..3081268 396..670 100 <- Minus
arm_2L 3080651..3080887 671..907 98 <- Minus
arm_2L 3071569..3071764 908..1103 100 <- Minus
arm_2L 3070823..3071504 1104..1785 99 <- Minus
arm_2L 3069396..3070731 1786..3121 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:50:44 Download gff for AT07210.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3094460..3094695 1..236 99   Minus
2L 3094217..3094375 237..395 100 <- Minus
2L 3080994..3081268 396..670 100 <- Minus
2L 3080651..3080887 671..907 98 <- Minus
2L 3071569..3071764 908..1103 100 <- Minus
2L 3070823..3071504 1104..1785 99 <- Minus
2L 3069396..3070731 1786..3121 99 <- Minus

AT07210.pep Sequence

Translation from 136 to 2802

> AT07210.pep
MGLRRFIRKHFGSKNSLGSAVKIIKSIENDELKNKRLNGTLASTAAIATP
IKGVATKSGATNKLQQSAKTKSTASIKSPAIVGVSEESLRSGVDQTELQE
LNNGQSATGCPTPPMARDSKRTSIGNELPCETEAKLKRCEDQQDPQASTT
ASPLPMINPQEQEASGQVKEATITTANEPNALSLPDEISNSVSSTTMLAT
PRVDIAAQYPVLKPFTENGELDCARLAKFFQDTQFERKEEQRQILGLSVM
VQFMSKELDAVACKENKHQCARTKGTLEKTILLLQHTQKDCERLREDLED
KGLEWIQRQQEKEYLHRTELKQAEEKLMEVQLRAKLKFCELESQLRAKDE
ESKQAQEAYRMEVSHKLALKQEHLRTAEQKIQELQTRLQQVETEEQGHRE
ELIRKENIHTARLAEANQREQDLIDRVKSLTKELNTLKANKEHNERDLRD
RLALSQDEISVLRTSSQRRSPCTSLPDNASAELNRLTSEADSLRCVLELK
QAEISALSKAKADLIHESEERLKLSNRVALLEAQNEMLRTELEAKTEKEK
EIQQKMEELQKAYKYESIKRTRLTYDKEELQYHLKQRSLQLQSAESKLQD
LSTGSHDNSLSSHSRCSLGRSGLEIAVTTSSPTSPVMKGMIERNDSVSWT
LEIEDESFKGNTSKIVRRAGSLRSNNERCPIQRRQTLTSNGHSNGSATNG
GSSPAHPNPLSQSMSATALLRSSSNSGESEGRPLSRARSKSMCIKASATS
SAVCESSGQRKKPQDELSLADWPEDIPLCSSSPQAPGIEMRPRSSTMKLM
SSEAKKFQEIQESAGEAMVSGANSEDESCSASSEDIMRSSSASSTASGGS
LSKRPKQPPSRMSIEEALPCTPMEVSWSEDAADANGLA*

AT07210.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20582-PA 2045 GF20582-PA 1183..2034 34..879 2785 67.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24460-PA 998 GG24460-PA 195..998 85..888 3802 90.9 Plus
Dere\GG24459-PA 1242 GG24459-PA 1184..1236 34..86 212 83 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10288-PA 949 GH10288-PA 171..947 87..885 1644 49.9 Plus
Dgri\GH23449-PA 303 GH23449-PA 1..207 258..469 487 53.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
toc-PC 888 CG9660-PC 1..888 1..888 4438 100 Plus
toc-PI 936 CG9660-PI 74..936 25..888 4273 99.2 Plus
toc-PH 993 CG9660-PH 91..945 34..888 4270 99.9 Plus
toc-PE 945 CG9660-PE 91..945 34..888 4270 99.9 Plus
toc-PD 984 CG9660-PD 130..984 34..888 4270 99.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17983-PA 2091 GI17983-PA 1229..2077 56..879 1561 47.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25837-PA 1109 GL25837-PA 305..1099 87..878 2257 61 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25463-PA 911 GA25463-PA 44..901 32..878 2323 59.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18169-PA 990 GM18169-PA 190..990 85..888 3899 93.9 Plus
Dsec\GM18168-PA 98 GM18168-PA 1..86 1..86 407 94.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22780-PA 914 GD22780-PA 283..914 257..888 3120 96.7 Plus
Dsim\GD22779-PA 99 GD22779-PA 1..86 1..86 381 88.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19558-PA 1983 GJ19558-PA 1116..1968 56..879 1887 54.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15039-PA 1017 GK15039-PA 208..997 87..879 1968 55.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14943-PA 991 GE14943-PA 199..991 85..888 3707 89.6 Plus
Dyak\GE14940-PA 1242 GE14940-PA 1177..1231 34..86 204 85.5 Plus

AT07210.hyp Sequence

Translation from 136 to 2802

> AT07210.hyp
MGLRRFIRKHFGSKNSLGSAVKIIKSIENDELKNKRLNGTLASTAAIATP
IKGVATKSGATNKLQQSAKTKSTASIKSPAIVGVSEESLRSGVDQTELQE
LNNGQSATGCPTPPMARDSKRTSIGNELPCETEAKLKRCEDQQDPQASTT
ASPLPMINPQEQEASGQVKEATITTANEPNALSLPDEISNSVSSTTMLAT
PRVDIAAQYPVLKPFTENGELDCARLAKFFQDTQFERKEEQRQILGLSVM
VQFMSKELDAVACKENKHQCARTKGTLEKTILLLQHTQKDCERLREDLED
KGLEWIQRQQEKEYLHRTELKQAEEKLMEVQLRAKLKFCELESQLRAKDE
ESKQAQEAYRMEVSHKLALKQEHLRTAEQKIQELQTRLQQVETEEQGHRE
ELIRKENIHTARLAEANQREQDLIDRVKSLTKELNTLKANKEHNERDLRD
RLALSQDEISVLRTSSQRRSPCTSLPDNASAELNRLTSEADSLRCVLELK
QAEISALSKAKADLIHESEERLKLSNRVALLEAQNEMLRTELEAKTEKEK
EIQQKMEELQKAYKYESIKRTRLTYDKEELQYHLKQRSLQLQSAESKLQD
LSTGSHDNSLSSHSRCSLGRSGLEIAVTTSSPTSPVMKGMIERNDSVSWT
LEIEDESFKGNTSKIVRRAGSLRSNNERCPIQRRQTLTSNGHSNGSATNG
GSSPAHPNPLSQSMSATALLRSSSNSGESEGRPLSRARSKSMCIKASATS
SAVCESSGQRKKPQDELSLADWPEDIPLCSSSPQAPGIEMRPRSSTMKLM
SSEAKKFQEIQESAGEAMVSGANSEDESCSASSEDIMRSSSASSTASGGS
LSKRPKQPPSRMSIEEALPCTPMEVSWSEDAADANGLA*

AT07210.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
toc-PC 888 CG9660-PC 1..888 1..888 4438 100 Plus
toc-PI 936 CG9660-PI 74..936 25..888 4273 99.2 Plus
toc-PH 993 CG9660-PH 91..945 34..888 4270 99.9 Plus
toc-PE 945 CG9660-PE 91..945 34..888 4270 99.9 Plus
toc-PD 984 CG9660-PD 130..984 34..888 4270 99.9 Plus