Clone AT10027 Report

Search the DGRC for AT10027

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:100
Well:27
Vector:pOTB7
Associated Gene/TranscriptGcn2-RA
Protein status:AT10027.pep: gold
Sequenced Size:5301

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Gcn2 2009-02-12 Manual selection by Sue Celniker

Clone Sequence Records

AT10027.complete Sequence

5301 bp assembled on 2010-08-12

GenBank Submission: BT126024.1

> AT10027.complete
GTACAAAATACGCAAAAAATTTTCTTTTTCCGGAAAATTAAGTGGAAAGC
GCAACAGGTTGTTCTCTTTACGCAACAAAAACGGCAGGAGTTCGCGTAGT
AACTCATTTCACATCGAATTCAAGTCGAATACAGCAGCAAAGTAATGCAG
CACGCAGCTGATTTGGAAACAGCTGCCAGCGCAGTTTGTGAAATTGCACA
CCGGCTAAAATAACCCGGTGGGAAATCCGAAGGAACTTCCGATCCAGTAT
TCCAAAGCACCCAGATGTAGCCAAGACTTATCCACTAACCGGAGATTTAA
TGCAGAAATGGCGGATGAAAAGGCCAAGGAATCCTTCCGCGAGCGGCAAG
CGCAGGAGTTGGAGGTTATAAAGTCCATCTTTGGCTGTGATGTGGAGGAC
CTAAGACCCCAGGCGAATCCTTCCCTGTGGAAGCCAACGGACATACGGAT
ACAACTTACCCCACTTCGAGACTCCTCGAACGGACTGGAAACCTATGTGT
GCACCAAGCTGCACGTCACCTGTCCATCAAAGTATCCAAAATTGCCCCCT
AAGATATCTCTGGAGGAGTCCAAAGGCATGTCGGATCAGCTGCTGGAGGC
CCTACGCAACCAATTGCAGGCTCAATCCCAAGAGCTACGTGGCGAAGTGA
TGATTTATGAATTGGCCCAGACCGTTCAGGCCTTTCTCCTCGAACACAAC
AAACCACCAAAGGGATCATTCTACGACCAGATGCTCCAGGATAAACAGAA
GCGCGACCAGGAGCTACAGGACATACAGCGGCAGCGGGAGTCCCTGCAAC
GCCAGACGCTCATCGACGAGGTGGAGCGGCGCAAAGAGATGTTCAAAACG
GAGGCTAAGAGGCGCGGCGAACCAAGGCGCAGCATGAGTGAGTCTAACCC
ACGGCATCCTAGCTCGTCGGAGAGCTCCGAGAACTCCTCGCCCTACTATC
GTGGTCACATCTACCCCTCCAAATGCCTGGATCACCGCAACACGGAGACG
CTCTACTTCCACAAGATGGGCAGGCAGATTCAGCGTGGATGCTGCGTTGG
TCACTCCCAACGAGGTTGCATCGCCTACACTGGCATAGATATGCACTGCG
GCCAGTTGCTCTACATAACAGAATGGAACATCAAGTACAGCCAACTGGAG
CAGCCATGCATCGGCGGAGGCAAGTGCCACTGGAGCAGCGAGTCAAAGTG
CATGGGCAGTCATCGTGTGGACGAAGTGATGGCCTCCATTGAAAAGCAGG
TGTCCTCACTGTCCCAACTACAGCACAAAAACCTCGTCTCGTACGAGTGC
GTACTGTGCATCAAGCGAAAGGAAGGTCTACTTGTGTATTTGGTCCAAGA
CTTCCTCCTTGGCACCAGCGTGTTCAGCATCTCCTCCTCGCTTGGCTGGT
GCATGGACGGCGCACGAATGGTTGCGCGCGGCGTGCTGGACGCCTTAGTA
TTTCTTCACAACAAGGGTGTATCCCATAGTCACCTGCTCGACACCACTGT
TTTTATGGACAACACAGGCAATGTGAGGGTATCAGACTTTTCGCTCGTTC
CCAATCTTCTAGAACTTCTGAGCGGAGCTGGACAAAGCAGCAGTTGCGGG
GACTTACCCGCGTTAGGTGCCCTGGTGGAGAGTTTGATGCCCACTAACAG
TTACGAGATGCGCGACTTTGTAGACAAGTGTAACTCGGACCGAACTCTTT
CCGCATCAGAGTTATTGGAGCATCCATTCTTACGCTTTTACGTCGACAAT
GGCCAGCAGCAGGTGATGCCATTACCACAGCAGCAACATCCTAACACCGT
CCAGCGCACTGGATCCGCCATGCCGTACCAGATACCGACACTGGCCCTAA
GCCAATCCCGCCTGCGAACGGAATTCGAGGTGCTCATGTACTTGGGAAAG
GGTGCCTTTGGTGACGTGCTAAAGGTGCGCAACATTTTAGACAACCGAGA
GTACGCCATCAAGCGCATACCATTGCCCGCGAGGAGTCGACAGCTGTACA
AAAAGATGACGCGCGAGGTGGAGCTTCTTTCGCGGCTGAATCATGAGAAT
GTAGTTCGATACTTTAACAGTTGGATAGAAAGTGTAGATGACGCAGATGC
CGCTGAGATGGATAAGCTGCTGGGCGGTGAGTGGTCCCAGAGTCAGCAGG
ACCTTAGCGTAAAACCTGCCAAGTCACCACAGCTGGGGCCCACTTTAGAG
GAGGACGAGGATGAAGAGGACAGCTCATCCAGCATGTGGAACGGTTACAT
ACCCAACATGGAGGACTCTGATTCGGATGGCATTGAATTTGTGGACTCCA
ACGGCAAGGTGGCTGTCTACGACGACGAAGAGCAGGAGGATTCCACCAGA
GGCAAGACCAATTCGCCAAAACCTTTGATGCAGGTCATGTACATCCAGAT
GGAGTTCTGTGAGAAATGCACATTGCGCACCGCCATCGATGACAATCTCT
TCAATGACACGGATCGTCTGTGGCGCTTATTTCGGGAGATTGCCGAGGGT
CTCGCGCATATTCACCAGCAAGGCATTATCCATCGGGACCTAAAGCCCGT
TAACATCTTCTTGGACTCGCACGATCAGATTAAGATCGGTGACTTTGGTC
TGGCCACCACCAGTTTTCTGGCTCTCCAAGCCCACGACGCAGCGCCTGCG
CCTGTTAACCAGATAACCAGTGCGGAAGACGGCACTGGTACTGGTAAGGT
CGGCACCACTCTATACGTGGCTCCCGAATTGACAGGAAATGCTTCCAAGT
CTGTGTACAACCAGAAGGTTGATATGTACACCCTGGGAATCATTCTTTTC
GAGATGTGCCAACCGCCGTTCGACACAAGCATGGAGCGGGCTCAGACCAT
TATGGCTCTCAGGAATGTTTCCATTAATATACCGGATGCTATGCTTAAGG
ATCCCAAGTATGAGAAGACGGTGAAGATGCTTCAGTGGCTTCTCAACCAC
GATCCCGCCCAGAGACCTACTGCCGAGGAGCTGCTCATCTCAGACCTGGT
TCCACCAGCCCAGTTGGAGGCCAATGAGCTCCAAGAAATGCTGCGTCACG
CCCTCGCTAATCCGCAGAGCAAGGCCTACAAGAACCTAGTTGCCCGATGT
CTTCAGCAGGAGAGCGACGAGGTGCTGGAACACACCTACCACTTGGGAAG
CAGTCGAGCTATGAAATCCTGGAACTCGGCAATTATAATCGATGATATAG
TATCCCTGAACCCAGTGATTGAGTTTGTTAAGGCTAAGGTCGTGAATTTA
TTCCGCAAGCATGGAGCTATAGAGGTGGACTCACCGCTCTTATCCCCACT
TTCCGCAAGGAACAGCACTGCGAATGCGAACGCCAATGCCGTACACCTTA
TGACCCACTCGGGATGTGTGGTGGTGCTACCCTGTGACCTGCGGACTCAG
TTTGCGCGTCACGTTACCATGAACAGCGTGAATCTCATCCGGCGCTACTG
TGTGGACCGTGTCTATCGGGAGGAGCGAGTGTTTAATTTTCATCCCAAGC
AAAGCTACGACTGCTCTTTCGATATAATTGCACCCACAACTGGAAGTCAT
TTAGTTGATGCCGAGCTGCTGTCGTTGGCTTTTGAAATCACCAGTGAACT
GCCCCGATTACGCGAAAAGAATTTGGCGATCCGCATGAACCACACTAATC
TCTTGAGGGCCATCCTCATCTTCTGCAATGTACCAAAGGCTCAGTATGGA
GCACTCTTCGAGGGCACCATGGACTTCATCGAGTCGCGCATCTCACGCTT
CCAATTTCACTCGAGTATTACCGGGATTATGGAAAAGTCGCGAACATCTG
CTCAAACTCTGATGGACATGTTGTTAGCTAACTTTCTGCTGACTGGTTCC
AGAAGCACTGTGGACGATTCCGCGCTGAAATCTTTGATGCGTGGAAAGGG
AGAAGCAGCTTCACTGGCAAGGGGAGCATTGCGGGAACTTGAAACAGTTG
TGGGACTGGCTTACAGTCTAGGCGTAAAGTGTCCTATACACATATGGGCT
GGCTTGCCCATCAGCTTCGATCGTGCCAGCAACGGTGGAATTGTGTGGCA
GATGACCGCTGACCTGAAGCCCAATCGCTCTGGCCATCCTTCGGTTCTGG
CGATTGGGGAGAGATACGACTCTATGCTGCATGAATTCCAGAAGCAGGCG
CAGAAGTTTAATCCCGCCATGCCAGCACGTGGAGTTCTTAGTGGAGCGGG
CTTGACGTTCTCCCTAGACAAGCTGGTAGCTGCTGTGGGTGTGGAATACG
CTAAGGATTGTCGGGCGATAGATGTGGGCATTTGCGTGTGTGGAACCCGT
CCACCGCTAAAGGATGTGACCTATATCATGCGTCTGCTGTGGTCGGTTGG
CATCCGATGTGGAATTGTGGAGGCCGCCAGCGAATTGGGAGATGAAGCAC
AGGATCTTGCCCGCCTTGGGGCGTTACATGTCATCCTGGTGGCGGAAAAT
GGCTCATTGAGAGTGAGATCTTTCGAGAGGGAACGATTCCAGGAGCGTCA
CCTAACAAGAACCGAACTGGTGGAGTTCATCCAGAAGATGCTGCGAAGTG
ATGGACTCAATGGGACCACCGTGGACAACTTCAGCCAGTTGTCAGCCTTG
GGTAGTGGTGACAACAGAAGCAGTGGTGGAAAGGAAAGAGAACGCGGCGA
GAATGGTCTGAGCACCTCCGCATCGAATGCCACCATCAAGAACAACTATA
GCCAGTTGCCGAATCTTCAGGTGACGTTTCTCACCCACGACAAGCCAACG
GCGAACTACAAAAGGCGGCTAGAGAATCAGGTGGCGCAGCAGATGAGCTC
AACGCTATCGCAGTTCCTCAAGAAGGAGACCTTTGTGGTCCTGGTGGTGG
AGTTGCCGCCTGCTGTTGTAAATGCCATTGTGGGGGCCATTAATCCACGG
GAAATACGCAAGCGAGAGACTGAACCGGAAATCAACTATGTGATCGAGCG
ATTTTCGAAATACAAGCGCTACATCTCCGAGATAAACGAAGAGGTTGTCG
ACTATCTGAGCGATGCCAAGACTCCCATTGTGGCCTTGTACAGCATATCC
GATTCCTACTACCGCGTCATCATCTAGCCAACATCAAATGCATAGAATCG
GCTGAACTACTTAGTAGACCAGCCAGTAGTGTAAGCTCGAAAGTGTCACA
AATTATTTTCGCCGAAATTCTACTTAACTGGCTGCCCTCCGTGCCATTAA
CACTTTTGAAATCAAAATTATGTTTATAGGCTTTGTTTGTGCGAATCAAA
ATTGATGAGATTGTATGTTTCTGTATCCATTTCAAAAAAAAAAAAAAAAA
A

AT10027.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Gcn2-RA 5769 Gcn2-RA 57..5264 1..5208 25980 99.9 Plus
Gcn2.a 5745 Gcn2.a 1081..5240 1049..5208 20755 99.9 Plus
Gcn2.a 5745 Gcn2.a 27..1077 1..1051 5240 99.9 Plus
Gcn2.a 5745 Gcn2.a 5241..5295 5232..5286 275 100 Plus
Gcn2-RA 5769 Gcn2-RA 5265..5319 5232..5286 275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27221360..27222415 2924..3979 5280 100 Plus
chr3R 27901430 chr3R 27222476..27223448 3978..4950 4850 99.9 Plus
chr3R 27901430 chr3R 27219245..27219875 1049..1679 3155 100 Plus
chr3R 27901430 chr3R 27219927..27220499 1678..2250 2865 100 Plus
chr3R 27901430 chr3R 27218662..27219169 544..1051 2525 99.8 Plus
chr3R 27901430 chr3R 27220805..27221304 2427..2926 2500 100 Plus
chr3R 27901430 chr3R 27217944..27218316 1..373 1865 100 Plus
chr3R 27901430 chr3R 27223510..27223843 4950..5283 1670 100 Plus
chr3R 27901430 chr3R 27220565..27220741 2251..2427 885 100 Plus
chr3R 27901430 chr3R 27218381..27218553 372..544 865 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Gcn2-RB 4770 CG1609-PB 1..4770 308..5077 23790 99.9 Plus
Gcn2-RA 4770 CG1609-PA 1..4770 308..5077 23790 99.9 Plus
Gcn2-RC 4776 CG1609-PC 1..4776 308..5077 23695 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Gcn2-RB 5284 CG1609-RB 25..5232 1..5208 25980 99.9 Plus
Gcn2-RA 5737 CG1609-RA 25..5232 1..5208 25980 99.9 Plus
Gcn2-RC 5290 CG1609-RC 25..5238 1..5208 25885 99.8 Plus
Gcn2-RB 5284 CG1609-RB 5233..5284 5232..5283 260 100 Plus
Gcn2-RA 5737 CG1609-RA 5233..5284 5232..5283 260 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Gcn2-PB 1589 CG1609-PB 1..1589 308..5074 7801 100 Plus
Gcn2-PA 1589 CG1609-PA 1..1589 308..5074 7801 100 Plus
Gcn2-PC 1591 CG1609-PC 1..1591 308..5074 7788 99.9 Plus
PEK-PC 1099 CG2087-PC 860..1083 2369..3046 290 35.8 Plus
PEK-PB 1110 CG2087-PB 871..1094 2369..3046 290 35.8 Plus
PEK-PC 1099 CG2087-PC 573..686 1856..2185 187 42.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31399100..31400155 2924..3979 5280 100 Plus
3R 32079331 3R 31400216..31401188 3978..4950 4835 99.8 Plus
3R 32079331 3R 31396985..31397615 1049..1679 3155 100 Plus
3R 32079331 3R 31397667..31398239 1678..2250 2850 99.8 Plus
3R 32079331 3R 31396402..31396909 544..1051 2525 99.8 Plus
3R 32079331 3R 31398545..31399044 2427..2926 2500 100 Plus
3R 32079331 3R 31395684..31396056 1..373 1865 100 Plus
3R 32079331 3R 31401250..31401508 4950..5208 1295 100 Plus
3R 32079331 3R 31398305..31398481 2251..2427 885 100 Plus
3R 32079331 3R 31396121..31396293 372..544 865 100 Plus
3R 32079331 3R 31401509..31401563 5232..5286 275 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 31139931..31140986 2924..3979 5280 100 Plus
3R 31820162 3R 31141047..31142019 3978..4950 4835 99.7 Plus
3R 31820162 3R 31137816..31138446 1049..1679 3155 100 Plus
3R 31820162 3R 31138498..31139070 1678..2250 2850 99.8 Plus
3R 31820162 3R 31137233..31137740 544..1051 2525 99.8 Plus
3R 31820162 3R 31139376..31139875 2427..2926 2500 100 Plus
3R 31820162 3R 31136515..31136887 1..373 1865 100 Plus
3R 31820162 3R 31142081..31142339 4950..5208 1295 100 Plus
3R 31820162 3R 31139136..31139312 2251..2427 885 100 Plus
3R 31820162 3R 31136952..31137124 372..544 865 100 Plus
3R 31820162 3R 31142340..31142394 5232..5286 275 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:37:15 has no hits.

AT10027.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:13:08 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27223511..27223843 4951..5283 100   Plus
chr3R 27222478..27223448 3980..4950 99 -> Plus
chr3R 27221363..27222415 2927..3979 100 -> Plus
chr3R 27220806..27221304 2428..2926 100 -> Plus
chr3R 27220565..27220741 2251..2427 100 -> Plus
chr3R 27219927..27220499 1678..2250 100 -> Plus
chr3R 27219246..27219873 1050..1677 100 -> Plus
chr3R 27218662..27219167 544..1049 99 -> Plus
chr3R 27218383..27218552 374..543 100 -> Plus
chr3R 27217944..27218316 1..373 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-12 09:42:16 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 1..4770 308..5077 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:50:37 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 1..4770 308..5077 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:47:28 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 1..4770 308..5077 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:13:08 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 1..4770 308..5077 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-12 09:42:16 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 27..5234 1..5208 99 == Plus
Gcn2-RA 5235..5286 5232..5283 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:50:37 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 5235..5286 5232..5283 100   Plus
Gcn2-RA 27..5234 1..5208 99 == Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:47:28 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 5233..5284 5232..5283 100   Plus
Gcn2-RA 25..5232 1..5208 99 == Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:13:08 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 5233..5284 5232..5283 100   Plus
Gcn2-RA 25..5232 1..5208 99 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:13:08 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31401509..31401560 5232..5283 100   Plus
3R 31401251..31401508 4951..5208 100 == Plus
3R 31400218..31401188 3980..4950 99 -> Plus
3R 31399103..31400155 2927..3979 100 -> Plus
3R 31398546..31399044 2428..2926 100 -> Plus
3R 31398305..31398481 2251..2427 100 -> Plus
3R 31397667..31398239 1678..2250 99 -> Plus
3R 31396986..31397613 1050..1677 100 -> Plus
3R 31396402..31396907 544..1049 99 -> Plus
3R 31396123..31396292 374..543 100 -> Plus
3R 31395684..31396056 1..373 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:47:28 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27227231..27227282 5232..5283 100   Plus
arm_3R 27226973..27227230 4951..5208 100 == Plus
arm_3R 27225940..27226910 3980..4950 99 -> Plus
arm_3R 27224825..27225877 2927..3979 100 -> Plus
arm_3R 27224268..27224766 2428..2926 100 -> Plus
arm_3R 27224027..27224203 2251..2427 100 -> Plus
arm_3R 27223389..27223961 1678..2250 99 -> Plus
arm_3R 27222708..27223335 1050..1677 100 -> Plus
arm_3R 27222124..27222629 544..1049 99 -> Plus
arm_3R 27221845..27222014 374..543 100 -> Plus
arm_3R 27221406..27221778 1..373 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:26:33 Download gff for AT10027.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31142340..31142391 5232..5283 100   Plus
3R 31142082..31142339 4951..5208 100 == Plus
3R 31141049..31142019 3980..4950 99 -> Plus
3R 31139934..31140986 2927..3979 100 -> Plus
3R 31139377..31139875 2428..2926 100 -> Plus
3R 31139136..31139312 2251..2427 100 -> Plus
3R 31138498..31139070 1678..2250 99 -> Plus
3R 31137817..31138444 1050..1677 100 -> Plus
3R 31137233..31137738 544..1049 99 -> Plus
3R 31136954..31137123 374..543 100 -> Plus
3R 31136515..31136887 1..373 100 -> Plus

AT10027.pep Sequence

Translation from 307 to 5076

> AT10027.pep
MADEKAKESFRERQAQELEVIKSIFGCDVEDLRPQANPSLWKPTDIRIQL
TPLRDSSNGLETYVCTKLHVTCPSKYPKLPPKISLEESKGMSDQLLEALR
NQLQAQSQELRGEVMIYELAQTVQAFLLEHNKPPKGSFYDQMLQDKQKRD
QELQDIQRQRESLQRQTLIDEVERRKEMFKTEAKRRGEPRRSMSESNPRH
PSSSESSENSSPYYRGHIYPSKCLDHRNTETLYFHKMGRQIQRGCCVGHS
QRGCIAYTGIDMHCGQLLYITEWNIKYSQLEQPCIGGGKCHWSSESKCMG
SHRVDEVMASIEKQVSSLSQLQHKNLVSYECVLCIKRKEGLLVYLVQDFL
LGTSVFSISSSLGWCMDGARMVARGVLDALVFLHNKGVSHSHLLDTTVFM
DNTGNVRVSDFSLVPNLLELLSGAGQSSSCGDLPALGALVESLMPTNSYE
MRDFVDKCNSDRTLSASELLEHPFLRFYVDNGQQQVMPLPQQQHPNTVQR
TGSAMPYQIPTLALSQSRLRTEFEVLMYLGKGAFGDVLKVRNILDNREYA
IKRIPLPARSRQLYKKMTREVELLSRLNHENVVRYFNSWIESVDDADAAE
MDKLLGGEWSQSQQDLSVKPAKSPQLGPTLEEDEDEEDSSSSMWNGYIPN
MEDSDSDGIEFVDSNGKVAVYDDEEQEDSTRGKTNSPKPLMQVMYIQMEF
CEKCTLRTAIDDNLFNDTDRLWRLFREIAEGLAHIHQQGIIHRDLKPVNI
FLDSHDQIKIGDFGLATTSFLALQAHDAAPAPVNQITSAEDGTGTGKVGT
TLYVAPELTGNASKSVYNQKVDMYTLGIILFEMCQPPFDTSMERAQTIMA
LRNVSINIPDAMLKDPKYEKTVKMLQWLLNHDPAQRPTAEELLISDLVPP
AQLEANELQEMLRHALANPQSKAYKNLVARCLQQESDEVLEHTYHLGSSR
AMKSWNSAIIIDDIVSLNPVIEFVKAKVVNLFRKHGAIEVDSPLLSPLSA
RNSTANANANAVHLMTHSGCVVVLPCDLRTQFARHVTMNSVNLIRRYCVD
RVYREERVFNFHPKQSYDCSFDIIAPTTGSHLVDAELLSLAFEITSELPR
LREKNLAIRMNHTNLLRAILIFCNVPKAQYGALFEGTMDFIESRISRFQF
HSSITGIMEKSRTSAQTLMDMLLANFLLTGSRSTVDDSALKSLMRGKGEA
ASLARGALRELETVVGLAYSLGVKCPIHIWAGLPISFDRASNGGIVWQMT
ADLKPNRSGHPSVLAIGERYDSMLHEFQKQAQKFNPAMPARGVLSGAGLT
FSLDKLVAAVGVEYAKDCRAIDVGICVCGTRPPLKDVTYIMRLLWSVGIR
CGIVEAASELGDEAQDLARLGALHVILVAENGSLRVRSFERERFQERHLT
RTELVEFIQKMLRSDGLNGTTVDNFSQLSALGSGDNRSSGGKERERGENG
LSTSASNATIKNNYSQLPNLQVTFLTHDKPTANYKRRLENQVAQQMSSTL
SQFLKKETFVVLVVELPPAVVNAIVGAINPREIRKRETEPEINYVIERFS
KYKRYISEINEEVVDYLSDAKTPIVALYSISDSYYRVII*

AT10027.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17784-PA 1584 GF17784-PA 3..1584 6..1589 7506 90.3 Plus
Dana\GF17710-PA 1168 GF17710-PA 928..1123 687..892 317 39.5 Plus
Dana\GF17866-PA 1573 GF17866-PA 1358..1541 694..893 210 28.9 Plus
Dana\GF21264-PA 285 GF21264-PA 79..251 696..875 203 31.8 Plus
Dana\GF20823-PA 613 GF20823-PA 103..286 694..893 201 32.4 Plus
Dana\GF17710-PA 1168 GF17710-PA 636..751 517..632 198 42 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11806-PA 1589 GG11806-PA 1..1589 1..1589 8463 98 Plus
Dere\GG11023-PA 1160 GG11023-PA 921..1115 688..892 298 37.9 Plus
Dere\GG12703-PA 291 GG12703-PA 85..228 696..854 213 33.1 Plus
Dere\GG18438-PA 582 GG18438-PA 103..286 694..893 203 32.4 Plus
Dere\GG16341-PA 1613 GG16341-PA 1396..1579 694..893 203 29.1 Plus
Dere\GG11023-PA 1160 GG11023-PA 638..758 517..637 195 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19296-PA 1587 GH19296-PA 3..1587 6..1589 6980 83.3 Plus
Dgri\GH23511-PA 1094 GH23511-PA 3..1094 498..1589 4792 83.2 Plus
Dgri\GH22593-PA 1188 GH22593-PA 946..1141 688..892 308 38.3 Plus
Dgri\GH24413-PA 603 GH24413-PA 103..286 694..893 205 32.9 Plus
Dgri\GH16081-PA 304 GH16081-PA 104..291 694..895 193 29.6 Plus
Dgri\GH22593-PA 1188 GH22593-PA 641..741 514..614 192 44.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
Gcn2-PB 1589 CG1609-PB 1..1589 1..1589 8192 100 Plus
Gcn2-PA 1589 CG1609-PA 1..1589 1..1589 8192 100 Plus
Gcn2-PC 1591 CG1609-PC 1..1591 1..1589 8179 99.9 Plus
PEK-PC 1099 CG2087-PC 860..1083 688..913 290 35.8 Plus
PEK-PB 1110 CG2087-PB 871..1094 688..913 290 35.8 Plus
PEK-PC 1099 CG2087-PC 573..693 517..637 192 39.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22205-PA 1598 GI22205-PA 3..1598 6..1589 6894 82.7 Plus
Dmoj\GI23641-PA 1176 GI23641-PA 927..1131 678..892 316 37.5 Plus
Dmoj\GI18916-PA 976 GI18916-PA 96..278 694..893 201 29.7 Plus
Dmoj\GI16230-PA 419 GI16230-PA 103..286 694..893 200 32.1 Plus
Dmoj\GI21956-PA 1588 GI21956-PA 1372..1555 694..893 192 28.2 Plus
Dmoj\GI23641-PA 1176 GI23641-PA 646..743 517..614 190 43.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27249-PA 1593 GL27249-PA 3..1593 6..1589 7290 87 Plus
Dper\GL22166-PA 1181 GL22166-PA 938..1132 688..892 290 36.9 Plus
Dper\GL23109-PA 1572 GL23109-PA 1357..1540 694..893 205 28.4 Plus
Dper\GL13846-PA 413 GL13846-PA 246..397 723..892 204 34.9 Plus
Dper\GL25881-PA 567 GL25881-PA 95..272 691..893 202 29.8 Plus
Dper\GL22166-PA 1181 GL22166-PA 646..766 517..637 191 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14045-PA 1593 GA14045-PA 3..1593 6..1589 7300 87.2 Plus
Dpse\GA15232-PA 1181 GA15232-PA 938..1132 688..892 290 36.9 Plus
Dpse\GA10994-PA 287 GA10994-PA 84..227 696..858 211 32.1 Plus
Dpse\GA25172-PA 567 GA25172-PA 95..277 691..898 209 30.3 Plus
Dpse\GA10134-PA 413 GA10134-PA 246..397 723..892 202 34.3 Plus
Dpse\GA15232-PA 1181 GA15232-PA 646..766 517..637 191 37.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12941-PA 1589 GM12941-PA 1..1589 1..1589 8500 98.6 Plus
Dsec\GM10634-PA 1164 GM10634-PA 925..1119 688..892 298 37.4 Plus
Dsec\GM18685-PA 1621 GM18685-PA 1404..1587 694..893 206 29.1 Plus
Dsec\GM13103-PA 609 GM13103-PA 135..318 694..893 205 32.4 Plus
Dsec\GM16553-PA 505 GM16553-PA 302..485 694..893 204 29.1 Plus
Dsec\GM10634-PA 1164 GM10634-PA 638..758 517..637 196 39.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21576-PA 1567 GD21576-PA 1..1567 1..1589 8146 97.6 Plus
Dsim\GD19618-PA 1084 GD19618-PA 845..1039 688..892 298 37.4 Plus
Dsim\GD16426-PA 291 GD16426-PA 85..228 696..854 217 33.7 Plus
Dsim\GD20154-PA 1621 GD20154-PA 1404..1587 694..893 206 29.1 Plus
Dsim\GD17041-PA 593 GD17041-PA 115..298 694..893 204 32.4 Plus
Dsim\GD19618-PA 1084 GD19618-PA 558..678 517..637 196 39.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24326-PA 1595 GJ24326-PA 3..1595 6..1589 7020 83.6 Plus
Dvir\GJ24717-PA 1165 GJ24717-PA 926..1120 688..892 307 38.3 Plus
Dvir\GJ14314-PA 1564 GJ14314-PA 1348..1531 694..893 204 28.4 Plus
Dvir\GJ15921-PA 540 GJ15921-PA 103..286 694..893 203 32.4 Plus
Dvir\GJ15228-PA 290 GJ15228-PA 83..227 696..854 198 31.1 Plus
Dvir\GJ24717-PA 1165 GJ24717-PA 639..736 517..614 193 44.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22763-PA 1607 GK22763-PA 3..1607 6..1589 6861 81.8 Plus
Dwil\GK22838-PA 1167 GK22838-PA 918..1114 686..892 310 38.3 Plus
Dwil\GK16236-PA 287 GK16236-PA 84..257 696..896 207 28.9 Plus
Dwil\GK13548-PA 1563 GK13548-PA 1348..1531 694..893 207 28.9 Plus
Dwil\GK20076-PA 419 GK20076-PA 103..286 694..893 201 32.4 Plus
Dwil\GK22838-PA 1167 GK22838-PA 630..727 517..614 197 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10941-PA 1590 GE10941-PA 1..1590 1..1589 8111 97.6 Plus
Dyak\GE25281-PA 1163 GE25281-PA 924..1118 688..892 292 37.4 Plus
Dyak\GE16532-PA 291 GE16532-PA 85..228 696..854 212 33.1 Plus
Dyak\GE25175-PA 1613 GE25175-PA 1396..1579 694..893 204 29.1 Plus
Dyak\GE15660-PA 606 GE15660-PA 103..286 694..893 202 32.4 Plus
Dyak\GE25281-PA 1163 GE25281-PA 638..753 517..632 197 41.2 Plus

AT10027.hyp Sequence

Translation from 307 to 5076

> AT10027.hyp
MADEKAKESFRERQAQELEVIKSIFGCDVEDLRPQANPSLWKPTDIRIQL
TPLRDSSNGLETYVCTKLHVTCPSKYPKLPPKISLEESKGMSDQLLEALR
NQLQAQSQELRGEVMIYELAQTVQAFLLEHNKPPKGSFYDQMLQDKQKRD
QELQDIQRQRESLQRQTLIDEVERRKEMFKTEAKRRGEPRRSMSESNPRH
PSSSESSENSSPYYRGHIYPSKCLDHRNTETLYFHKMGRQIQRGCCVGHS
QRGCIAYTGIDMHCGQLLYITEWNIKYSQLEQPCIGGGKCHWSSESKCMG
SHRVDEVMASIEKQVSSLSQLQHKNLVSYECVLCIKRKEGLLVYLVQDFL
LGTSVFSISSSLGWCMDGARMVARGVLDALVFLHNKGVSHSHLLDTTVFM
DNTGNVRVSDFSLVPNLLELLSGAGQSSSCGDLPALGALVESLMPTNSYE
MRDFVDKCNSDRTLSASELLEHPFLRFYVDNGQQQVMPLPQQQHPNTVQR
TGSAMPYQIPTLALSQSRLRTEFEVLMYLGKGAFGDVLKVRNILDNREYA
IKRIPLPARSRQLYKKMTREVELLSRLNHENVVRYFNSWIESVDDADAAE
MDKLLGGEWSQSQQDLSVKPAKSPQLGPTLEEDEDEEDSSSSMWNGYIPN
MEDSDSDGIEFVDSNGKVAVYDDEEQEDSTRGKTNSPKPLMQVMYIQMEF
CEKCTLRTAIDDNLFNDTDRLWRLFREIAEGLAHIHQQGIIHRDLKPVNI
FLDSHDQIKIGDFGLATTSFLALQAHDAAPAPVNQITSAEDGTGTGKVGT
TLYVAPELTGNASKSVYNQKVDMYTLGIILFEMCQPPFDTSMERAQTIMA
LRNVSINIPDAMLKDPKYEKTVKMLQWLLNHDPAQRPTAEELLISDLVPP
AQLEANELQEMLRHALANPQSKAYKNLVARCLQQESDEVLEHTYHLGSSR
AMKSWNSAIIIDDIVSLNPVIEFVKAKVVNLFRKHGAIEVDSPLLSPLSA
RNSTANANANAVHLMTHSGCVVVLPCDLRTQFARHVTMNSVNLIRRYCVD
RVYREERVFNFHPKQSYDCSFDIIAPTTGSHLVDAELLSLAFEITSELPR
LREKNLAIRMNHTNLLRAILIFCNVPKAQYGALFEGTMDFIESRISRFQF
HSSITGIMEKSRTSAQTLMDMLLANFLLTGSRSTVDDSALKSLMRGKGEA
ASLARGALRELETVVGLAYSLGVKCPIHIWAGLPISFDRASNGGIVWQMT
ADLKPNRSGHPSVLAIGERYDSMLHEFQKQAQKFNPAMPARGVLSGAGLT
FSLDKLVAAVGVEYAKDCRAIDVGICVCGTRPPLKDVTYIMRLLWSVGIR
CGIVEAASELGDEAQDLARLGALHVILVAENGSLRVRSFERERFQERHLT
RTELVEFIQKMLRSDGLNGTTVDNFSQLSALGSGDNRSSGGKERERGENG
LSTSASNATIKNNYSQLPNLQVTFLTHDKPTANYKRRLENQVAQQMSSTL
SQFLKKETFVVLVVELPPAVVNAIVGAINPREIRKRETEPEINYVIERFS
KYKRYISEINEEVVDYLSDAKTPIVALYSISDSYYRVII*

AT10027.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:00:23
Subject Length Description Subject Range Query Range Score Percent Strand
Gcn2-PB 1589 CG1609-PB 1..1589 1..1589 8192 100 Plus
Gcn2-PA 1589 CG1609-PA 1..1589 1..1589 8192 100 Plus
Gcn2-PC 1591 CG1609-PC 1..1591 1..1589 8179 99.9 Plus
PEK-PC 1099 CG2087-PC 860..1083 688..913 290 35.8 Plus
PEK-PB 1110 CG2087-PB 871..1094 688..913 290 35.8 Plus
PEK-PC 1099 CG2087-PC 573..693 517..637 192 39.5 Plus