Clone AT10306 Report

Search the DGRC for AT10306

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:103
Well:6
Vector:pOTB7
Associated Gene/Transcriptorb-RB
Protein status:AT10306.pep: gold
Sequenced Size:2988

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
orb-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

AT10306.complete Sequence

2988 bp assembled on 2009-08-31

GenBank Submission: BT099670.1

> AT10306.complete
AAGGATTCCATCAGGATCAGTGCACACATGTTGGGAGTCGAGAAGCCATA
TGTGGTAGAGCCAGCTATGGCCGTAGCGCAGGACTCGTTTGAATTTGGCA
GCAACGGCGATGGGAGCTCCACCAACAGCCACACAAGCAACGCCAGCTCC
AAGGACCTTGGCAGACTGACTAGTGGCGACGGAGCCCAGAACTTCGCCCA
AGACAGCAGTGCCAACAGCATTGACCAGGACAGCACGGACAACACAAACA
GCGACTGCAATCCAATCACACTGAACGATCTACTCGGCTTGTGCGGTGCC
AGCACTGCCAATGAAGTGGTCGGTACTGGCCAGACCCCCTCGACATCAGC
GCCGATACTTGGAGCAGGAGGAGGCGGAAGAGCAAATGGAGTTACAGCCG
GCGCAGCAACGGCAACAGGAGTGGGAGTTGGAGCTGGAGGGACATTACCT
GGGCCAGGAGTTCCATCGATCCAGGGAGGTGGTGGAGGAGGAGTCGTGGG
ACAACAAACCAATGCCTCGTGCAACACCTCAGCGGCTAACCCATCAGCCA
GCTTCGGTGGCAACGGCAGCAGCAGCGACGTCAATAATCTGCTGCTCGCC
AGTGCTGCTGCCGCTGCCGCCGCGGCTGCCGGTGATGGCGCTCAACTGTC
CGCCAATGCGGCAGCCTACGCTCCGCTGACGCCCAGCTCCACTCATTCAT
CGGCCTCGCCGGGCACAAAGTCCAATTTTGACTACTTCCAGTTTGAAAAT
GTTGCACAAAGTAACCCACTTAAGGCTTTCCAAAGAACAAACATCAGCTT
CGATTGCTCTGCACCCTTATCGCCAAGTACGCCTACATCTATTTACAATC
GCTCCTTTCACAGTTCACCTTTAGTCAGCGACAGCAGCAACTCGTCCAGC
GGCATTGGACTCTCCATGGACTCCATCAACATGTTCTACAACCAGCAACA
ACAACAGCAACAGCCGGAGCAGCAAGGTTACACCAGTTTGGGCAACTCCA
TGGGCAGCGGATTGGGACTTAGTTTGGCAAACGCTTCCACGCGCTCGAAC
TCGCCAGAGAGTCAGAACAGCAGCAATTCAACGACTGAACAAAATCTACT
GGACATGATTAATTTGCTGTCTGTAAATAGCAACAAAATTCCACATCAAC
AACAGCAACAACAACAGCAGCAGCAGCAACAACAGCAGCAGCAACAACAG
AATCAGCAGCAATTGCAGGTTCAGCAACAACATCAGTTGCAGCAGCAGTT
TGTTAACCTAAACAGGAACTACGAGCAACAGATATCTGCCAATTTGGGTA
GCCAACAACATGGGTTCGAGCACAACGGCGTGGGTGTGGGTGCTTCTAGT
AGCGGAAATGAGAACTGCTTTAGCCAGTATAATCTAGAAAACATCACCAG
TGTGGACATGGAGCTGGCCAAACTGCAGAATTTGCAACGCATCAACACGC
TAAAGCTCCTGCATGCCCAAGCTCAACAAATGCCGCTGATCAACCAGCTC
CTGCAGAGCTATGCCGGCAACGCCATAGGCAGCGTCGGTGGAAGCAATCT
TGGTAACTTGATGAGCGCAGGCGGATCATCACTGATGACAGAAATGGCGG
GAAACGTTGGCGGCATTATAACCACCAACGATGGCCACCTGGATCGCGTA
GCTAAGTTCTATAAGAGTTCGGCTGCCCTGTGCGATGCCACATGCACATG
GAGTGGACACCTGCCGCCGCGTTCGCACCGTATGCTCAACTATTCTCCCA
AGGTCTTCCTCGGCGGGATTCCCTGGGATATTAGTGAGCAGTCGCTCATC
CAGATCTTCAAGCCATTTGGATCTATTAAAGTGGAGTGGCCCGGCAAGGA
GCAGCAGGCGGCTCAGCCCAAGGGTTATGTTTACATAATCTTTGAATCGG
ACAAGCAGGTCAAGGCATTACTTTCGGCCTGTGTGCTTCAGGTGGATGAT
TCTCACTGTGGTAGGAACTACTTCTTCAAAATCTCTTCGCGGCGTATTAA
GTCCAAGGATGTTGAAGTCATTCCTTGGATTATCGCTGACTCCAATTTTG
TGCGATCCAGCTCCCAGAAACTTGACCCAACGAAAACCGTGTTTGTGGGC
GCACTGCATGGAAAACTGACTGCCGAGGGCTTGGGAAATATAATGGATGA
TCTTTTCGACGGCGTGCTGTATGCTGGTATAGATACGGACAAGTACAAGT
ACCCGATCGGATCGGGACGTGTGACATTTAGCAACTTTCGCTCCTACATG
AAAGCTGTTTCGGCCGCCTTTATCGAGATTAGGACCACGAAGTTCACCAA
GAAGGTGCAGGTGGATCCCTACTTGGAGGATGCCCTATGTTCCATATGCG
GTGTGCAGCACGGTCCCTACTATTGTAGGGAATTATCGTGCTTCCGATAC
TTCTGCCGCAGCTGCTGGCAATGGCAGCACAGCTGTGACATCGTCAAAAA
TCACAAGCCCTTGACTCGCAACTCCAAGTCGCAGAGCCTGGTTGGCATCG
GACCATCTTCGTCGAATGTTTCGTTACCCTTCTCTGGCCAACGAAGTATC
AGGGACAACAGAATGGGGAACGGTCAGCATCAACAGCACCAGCAGCATCA
GTACCAACAGCAGAAACACCGTCAGCTGCAAGAATACTCGCAGCCCCACA
GTCTCAACGTGATGGGAAACTCAGGAGCTGCCAATGCCGCTGCTACATCA
ATGGTAACTCTTCAGCAGCGGCAAATTCACAAGGTGCGAATACAGCGTCA
ACAGCATCAGGCGATCTAGACTGTTACGGCTTTTATCCACACCGTTTTAA
CGGATGTTTCCGCAATATAATGTGTGAGACTTTGGACTTGTAGGCGACGT
AGAAATATGGCGGAGATAGTTTTCTTGCAGCCGATGGAGACCCGGGCTCA
TCATCGTCATTATCATTGTAAACACAGTTTTATTGATGTGTATATAATAT
CGGTACAATATGAAGCTTAAAAAAAAAAAAAAAAAAAA

AT10306.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
orb-RB 3364 orb-RB 283..3251 1..2969 14800 99.8 Plus
orb-RD 3364 orb-RD 283..3251 1..2969 14800 99.8 Plus
orb.e 3743 orb.e 673..3641 1..2969 14800 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19090374..19091092 1829..1111 3580 99.9 Minus
chr3R 27901430 chr3R 19089066..19089638 2968..2396 2865 100 Minus
chr3R 27901430 chr3R 19092534..19093015 741..260 2410 100 Minus
chr3R 27901430 chr3R 19089692..19090077 2396..2011 1915 99.7 Minus
chr3R 27901430 chr3R 19093163..19093421 259..1 1280 99.6 Minus
chr3R 27901430 chr3R 19091475..19091709 1110..876 1175 100 Minus
chr3R 27901430 chr3R 19090131..19090313 2012..1830 915 100 Minus
chr3R 27901430 chr3R 19091796..19091934 878..740 695 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
orb-RD 2742 CG10868-PD 1..2742 28..2769 13665 99.9 Plus
orb-RB 2742 CG10868-PB 1..2742 28..2769 13665 99.9 Plus
orb-RG 2748 CG10868-PG 239..2748 260..2769 12520 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:52 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
orb-RD 3258 CG10868-RD 277..3244 1..2968 14795 99.9 Plus
orb-RB 4251 CG10868-RB 277..3244 1..2968 14795 99.9 Plus
orb-RF 3079 CG10868-RF 321..3079 210..2968 13765 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
orb-PD 913 CG10868-PD 1..913 28..2766 3308 100 Plus
orb-PB 913 CG10868-PB 1..913 28..2766 3308 100 Plus
orb-PG 915 CG10868-PG 80..915 259..2766 2978 99.9 Plus
orb-PA 915 CG10868-PA 80..915 259..2766 2978 99.9 Plus
orb-PF 617 CG10868-PF 5..617 928..2766 2452 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23266962..23267680 1829..1111 3580 99.9 Minus
3R 32079331 3R 23265653..23266226 2969..2396 2870 100 Minus
3R 32079331 3R 23269122..23269603 741..260 2410 100 Minus
3R 32079331 3R 23266280..23266665 2396..2011 1915 99.7 Minus
3R 32079331 3R 23269751..23270009 259..1 1280 99.6 Minus
3R 32079331 3R 23268063..23268297 1110..876 1175 100 Minus
3R 32079331 3R 23266719..23266901 2012..1830 915 100 Minus
3R 32079331 3R 23268384..23268522 878..740 695 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23007793..23008511 1829..1111 3580 99.8 Minus
3R 31820162 3R 23006484..23007057 2969..2396 2870 100 Minus
3R 31820162 3R 23009953..23010434 741..260 2410 100 Minus
3R 31820162 3R 23007111..23007496 2396..2011 1915 99.7 Minus
3R 31820162 3R 23010582..23010840 259..1 1280 99.6 Minus
3R 31820162 3R 23008894..23009128 1110..876 1175 100 Minus
3R 31820162 3R 23007550..23007732 2012..1830 915 100 Minus
3R 31820162 3R 23009215..23009353 878..740 695 100 Minus
Blast to na_te.dros performed 2014-11-26 20:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2319..2731 876..1281 289 56.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2600..2902 920..1241 262 58.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2273..2642 883..1248 247 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2323..2536 2548..2762 226 59.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6766..7125 920..1283 222 56.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6810..6947 2545..2684 207 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1506..1601 2537..2636 157 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6824..6944 2539..2658 152 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1533..1587 915..970 151 76.8 Plus
roo 9092 roo DM_ROO 9092bp 1100..1171 924..995 134 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1517..1583 942..1010 133 68.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6773..6903 876..1012 131 57.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6785 941..1008 128 67.6 Plus
roo 9092 roo DM_ROO 9092bp 1071..1102 944..975 124 87.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2782..2848 917..974 116 71.6 Plus

AT10306.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:23:42 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19093163..19093421 1..259 99   Minus
chr3R 19092687..19093015 260..588 100 <- Minus
chr3R 19092534..19092632 643..741 100 == Minus
chr3R 19091796..19091932 742..878 100 <- Minus
chr3R 19091475..19091706 879..1110 100 <- Minus
chr3R 19091060..19091092 1111..1143 100 <- Minus
chr3R 19090374..19090970 1233..1829 100 == Minus
chr3R 19090133..19090313 1830..2010 100 <- Minus
chr3R 19089692..19090077 2011..2396 99 <- Minus
chr3R 19089460..19089637 2397..2574 100 <- Minus
chr3R 19089066..19089403 2631..2968 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:15:09 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RD 1..2742 28..2769 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:10:52 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RD 1..2742 28..2769 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:59:18 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RB 1..2742 28..2769 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:42 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RB 1..2742 28..2769 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-31 21:03:39 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RD 277..3244 1..2968 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:10:52 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RD 277..3244 1..2968 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:59:18 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RB 277..3244 1..2968 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:42 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RB 277..3244 1..2968 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:23:42 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23269751..23270009 1..259 99   Minus
3R 23269122..23269603 260..741 100 <- Minus
3R 23268384..23268520 742..878 100 <- Minus
3R 23268063..23268294 879..1110 100 <- Minus
3R 23266962..23267680 1111..1829 99 <- Minus
3R 23266721..23266901 1830..2010 100 <- Minus
3R 23266280..23266665 2011..2396 99 <- Minus
3R 23265654..23266225 2397..2968 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:59:18 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19095473..19095731 1..259 99   Minus
arm_3R 19094844..19095325 260..741 100 <- Minus
arm_3R 19094106..19094242 742..878 100 <- Minus
arm_3R 19093785..19094016 879..1110 100 <- Minus
arm_3R 19092684..19093402 1111..1829 99 <- Minus
arm_3R 19092443..19092623 1830..2010 100 <- Minus
arm_3R 19092002..19092387 2011..2396 99 <- Minus
arm_3R 19091376..19091947 2397..2968 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:02:15 Download gff for AT10306.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23010582..23010840 1..259 99   Minus
3R 23009953..23010434 260..741 100 <- Minus
3R 23009215..23009351 742..878 100 <- Minus
3R 23008894..23009125 879..1110 100 <- Minus
3R 23007793..23008511 1111..1829 99 <- Minus
3R 23007552..23007732 1830..2010 100 <- Minus
3R 23007111..23007496 2011..2396 99 <- Minus
3R 23006485..23007056 2397..2968 100 <- Minus

AT10306.pep Sequence

Translation from 0 to 2768

> AT10306.pep
KDSIRISAHMLGVEKPYVVEPAMAVAQDSFEFGSNGDGSSTNSHTSNASS
KDLGRLTSGDGAQNFAQDSSANSIDQDSTDNTNSDCNPITLNDLLGLCGA
STANEVVGTGQTPSTSAPILGAGGGGRANGVTAGAATATGVGVGAGGTLP
GPGVPSIQGGGGGGVVGQQTNASCNTSAANPSASFGGNGSSSDVNNLLLA
SAAAAAAAAAGDGAQLSANAAAYAPLTPSSTHSSASPGTKSNFDYFQFEN
VAQSNPLKAFQRTNISFDCSAPLSPSTPTSIYNRSFHSSPLVSDSSNSSS
GIGLSMDSINMFYNQQQQQQQPEQQGYTSLGNSMGSGLGLSLANASTRSN
SPESQNSSNSTTEQNLLDMINLLSVNSNKIPHQQQQQQQQQQQQQQQQQQ
NQQQLQVQQQHQLQQQFVNLNRNYEQQISANLGSQQHGFEHNGVGVGASS
SGNENCFSQYNLENITSVDMELAKLQNLQRINTLKLLHAQAQQMPLINQL
LQSYAGNAIGSVGGSNLGNLMSAGGSSLMTEMAGNVGGIITTNDGHLDRV
AKFYKSSAALCDATCTWSGHLPPRSHRMLNYSPKVFLGGIPWDISEQSLI
QIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSACVLQVDD
SHCGRNYFFKISSRRIKSKDVEVIPWIIADSNFVRSSSQKLDPTKTVFVG
ALHGKLTAEGLGNIMDDLFDGVLYAGIDTDKYKYPIGSGRVTFSNFRSYM
KAVSAAFIEIRTTKFTKKVQVDPYLEDALCSICGVQHGPYYCRELSCFRY
FCRSCWQWQHSCDIVKNHKPLTRNSKSQSLVGIGPSSSNVSLPFSGQRSI
RDNRMGNGQHQQHQQHQYQQQKHRQLQEYSQPHSLNVMGNSGAANAAATS
MVTLQQRQIHKVRIQRQQHQAI*

AT10306.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18019-PA 966 GF18019-PA 211..931 211..901 2596 78.6 Plus
Dana\GF20644-PA 237 GF20644-PA 1..207 715..901 728 71.5 Plus
Dana\GF10140-PA 725 GF10140-PA 466..711 581..823 544 40.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12446-PA 1007 GG12446-PA 93..1007 1..919 3302 81.3 Plus
Dere\GG15051-PA 708 GG15051-PA 449..694 581..823 533 40.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19071-PA 974 GH19071-PA 225..405 194..380 553 70.5 Plus
Dgri\GH16131-PA 745 GH16131-PA 486..731 581..823 536 40.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
orb-PD 913 CG10868-PD 1..913 10..922 4732 100 Plus
orb-PB 913 CG10868-PB 1..913 10..922 4732 100 Plus
orb-PG 915 CG10868-PG 80..915 87..922 4332 99.9 Plus
orb-PA 915 CG10868-PA 80..915 87..922 4332 99.9 Plus
orb-PF 617 CG10868-PF 1..617 306..922 3226 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23215-PA 1039 GI23215-PA 524..932 417..835 1832 79.7 Plus
Dmoj\GI12400-PA 752 GI12400-PA 493..738 581..823 535 40.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23035-PA 838 GL23035-PA 142..736 215..842 2365 78.5 Plus
Dper\GL20808-PA 694 GL20808-PA 435..680 581..823 535 40.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:31:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10609-PB 922 GA10609-PB 223..817 215..842 2404 79.5 Plus
Dpse\GA19094-PA 716 GA19094-PA 457..702 581..823 537 40.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23578-PA 1017 GM23578-PA 107..1017 9..922 3883 92.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18393-PA 914 GD18393-PA 82..914 87..922 3516 93.2 Plus
Dsim\GD12954-PA 331 GD12954-PA 163..317 676..823 355 43.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22874-PA 1013 GJ22874-PA 507..944 417..866 1826 76 Plus
Dvir\GJ12289-PA 738 GJ12289-PA 479..724 581..823 532 40.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11581-PA 909 GK11581-PA 170..817 211..842 2445 77.5 Plus
Dwil\GK17460-PA 753 GK17460-PA 494..739 581..823 534 40.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23969-PA 1014 GE23969-PA 102..1014 10..919 3254 80.7 Plus
Dyak\GE21274-PA 709 GE21274-PA 450..695 581..823 536 40.1 Plus

AT10306.hyp Sequence

Translation from 0 to 2768

> AT10306.hyp
KDSIRISAHMLGVEKPYVVEPAMAVAQDSFEFGSNGDGSSTNSHTSNASS
KDLGRLTSGDGAQNFAQDSSANSIDQDSTDNTNSDCNPITLNDLLGLCGA
STANEVVGTGQTPSTSAPILGAGGGGRANGVTAGAATATGVGVGAGGTLP
GPGVPSIQGGGGGGVVGQQTNASCNTSAANPSASFGGNGSSSDVNNLLLA
SAAAAAAAAAGDGAQLSANAAAYAPLTPSSTHSSASPGTKSNFDYFQFEN
VAQSNPLKAFQRTNISFDCSAPLSPSTPTSIYNRSFHSSPLVSDSSNSSS
GIGLSMDSINMFYNQQQQQQQPEQQGYTSLGNSMGSGLGLSLANASTRSN
SPESQNSSNSTTEQNLLDMINLLSVNSNKIPHQQQQQQQQQQQQQQQQQQ
NQQQLQVQQQHQLQQQFVNLNRNYEQQISANLGSQQHGFEHNGVGVGASS
SGNENCFSQYNLENITSVDMELAKLQNLQRINTLKLLHAQAQQMPLINQL
LQSYAGNAIGSVGGSNLGNLMSAGGSSLMTEMAGNVGGIITTNDGHLDRV
AKFYKSSAALCDATCTWSGHLPPRSHRMLNYSPKVFLGGIPWDISEQSLI
QIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSACVLQVDD
SHCGRNYFFKISSRRIKSKDVEVIPWIIADSNFVRSSSQKLDPTKTVFVG
ALHGKLTAEGLGNIMDDLFDGVLYAGIDTDKYKYPIGSGRVTFSNFRSYM
KAVSAAFIEIRTTKFTKKVQVDPYLEDALCSICGVQHGPYYCRELSCFRY
FCRSCWQWQHSCDIVKNHKPLTRNSKSQSLVGIGPSSSNVSLPFSGQRSI
RDNRMGNGQHQQHQQHQYQQQKHRQLQEYSQPHSLNVMGNSGAANAAATS
MVTLQQRQIHKVRIQRQQHQAI*

AT10306.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
orb-PD 913 CG10868-PD 1..913 10..922 4732 100 Plus
orb-PB 913 CG10868-PB 1..913 10..922 4732 100 Plus
orb-PG 915 CG10868-PG 80..915 87..922 4332 99.9 Plus
orb-PA 915 CG10868-PA 80..915 87..922 4332 99.9 Plus
orb-PF 617 CG10868-PF 1..617 306..922 3226 100 Plus