Clone AT15596 Report

Search the DGRC for AT15596

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:155
Well:96
Vector:pOTB7
Associated Gene/TranscriptCG45186-RA
Protein status:AT15596.pep: gold
Sequenced Size:1816

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32306-RA 2009-06-22 Replacement based on scoring

Clone Sequence Records

AT15596.complete Sequence

1816 bp assembled on 2009-09-22

GenBank Submission: BT099803.1

> AT15596.complete
GTCAAATTTTAAATGTTATTAGTAGTACACTCGACGAGAAAGCACAAAAC
AATTTTATTATTCTTGTTTGGGATGCATCATTTGATTTATTAACTTAGAT
ATGCCTACCACAATCAAGCGGCACAGTACAACCATTGTAATCAAATCATC
CATTTCAGGAACCACCAACTCCCGTCAATCTCCACCAGCGTCGTCGGCGG
AGGTGTCTTCAAGTGCAGCCGACAATTCCATGCACAGTGACGAGCGGTCC
ACGCCAAATGCAACGATAGATGCGGAATTCGAACCCTCATCCCTGTCGCT
GGCTGAGCGACTGGCCTTCTTCAGCAATCTGTGCGAGAGCGGCGGAGGAG
GTGGGAGTACCAGTGCCGGTGGAAGGTACCGCAGTCGCACCAGCAGCTAT
TCAAGGAGTCCGCCCGGCGATCGCACCACTCCCAGGAGCAGCACCACCGC
CAGCAGTGTCAGTATGACGCCCACGCCCATGGATTACTCTCCGATTCCCC
ACGACAAGGAGCCATCTAGTCTCACGCTGGAGAGCATCATCGAGCCCGAG
CAGGAGGAGGTCAAGGAGCAGGTGGACCAGGATGAGGTCAAGTTGAGGAA
GAAGGAGCCAGTCCAGAGGGAATCTTCCCAGCACAATGGCTTCCACGTGC
TGACCAGGTCCGCCACCGAACCGCCGTCGTCCACCTCGCCCCTGCGCATC
AGCATACGGACTGTGGGAAAGCTAGTCCTGCCCGATACCTTCCGCGGCGA
TCGCAACAATAACAGCAGTAGTAGAAGTGGGAGCAACAGCTGGAGCAACA
CTTGCATGGTCAAGCTGCAGAGCTTGGAGCCCGTTAGCCTGTCCGTTCAT
TCGCGCACCATTGGTAAGGTTAAGTCGCCATTCATTGAAAAGCAGCAGGA
GAAACCACACACCGAGAAGCTAGCGAACGGAACCAGCGACAGTGGCTCCG
ATTCGGGCAAGGAGAACTGCGCCTCCAACGAGCAGGAACATCTGCAGCAC
CAGCAGTCGCAGGACGAGGATCGAGCTCCGCCCAGGGTGTCCGAGATGCG
GAGGAAAATCAGCCGACTGGTGCAACAACAGCAGCCGCAACCACAGCCCG
TCAATCGGCGGCACACCACCGAGATCACCTCCGTGACCGTTGGAACGCGT
TCGCCCAGTGTGGACGATCGCTTTGCCAAGTACTTTGGTGTTAAGGAGAG
CTGCAACAGCACGACCACCGTGCATAAAACGCAATCGCTGCCACCCAGCC
AAGTTGAGGCCACCAATGCGCACGTGAAACTACCGCAGATCACTACCGTG
GTTTCCAAACGGCGCGAGCTGCTCAAGAGGACGCGACCCCTGTCCATGGA
TCACTACTCCAGCGGCTGCACCAGTCCCACAGCCATGCCAAGTCCCAAGA
GAGCACATTCGCCCGTCGGCCGGCGGAAGGCCGCCATTTCCAGCATCGAG
GACATTGAGGTCACGCCGGATGAACTCCGGGCCGCTGGCAGGAACTTCAA
GCTGTTGTACGGCGAGTTATTGGGCTGAAAAATTGTCTATTTTGGCCGAG
CATTCAAAATTTCCCAATTTTTCCAAATCCCCGAAATCCCAAACACAAAC
ACAAATATTGCTCTCTTCGTGTGGGTCCGCGCTCAGTGTGATAGATGCGT
CCGATCCTGATTCCAAGCTATTAAGCTAACTAGTTGTCTCATAGTAATCC
CAATAATGAAAACAAACTGAACGAAACGAAAATTCCACAGATATGTCAAG
CGAAAACGAAGTAATAAATGAAATAAACTATGTATGTTAGAAATGTAAAA
AAAAAAAAAAAAAAAA

AT15596.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32306-RA 2115 CG32306-RA 42..1838 1..1797 8985 100 Plus
CG32306-RF 5658 CG32306-RF 3742..5381 158..1797 8200 100 Plus
CG32306-RD 7201 CG32306-RD 5285..6924 158..1797 8200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2462555..2464070 281..1796 7490 99.6 Plus
chr3L 24539361 chr3L 2460487..2460767 1..281 1390 99.6 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG45186-RA 1428 CG45186-PA 1..1428 101..1528 7140 100 Plus
CG45186-RAD 10422 CG45186-PAD 9052..10422 158..1528 6855 100 Plus
CG45186-RAC 9348 CG45186-PAC 7978..9348 158..1528 6855 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:50:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG45186-RA 2084 CG45186-RA 11..1806 1..1796 8980 100 Plus
CG45186-RAD 11244 CG45186-RD 9328..10966 158..1796 8195 100 Plus
CG45186-RAC 10679 CG45186-RC 8763..10401 158..1796 8195 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG45186-PA 475 CG45186-PA 1..475 101..1525 1827 100 Plus
CG45186-PP 663 CG45186-PP 207..663 155..1525 1737 99.8 Plus
CG45186-PF 1400 CG45186-PF 944..1400 155..1525 1737 99.8 Plus
CG45186-PU 1519 CG45186-PU 1063..1519 155..1525 1737 99.8 Plus
CG45186-PV 1574 CG45186-PV 1118..1574 155..1525 1737 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2463056..2464572 281..1797 7585 100 Plus
3L 28110227 3L 2460988..2461268 1..281 1405 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2463056..2464572 281..1797 7585 100 Plus
3L 28103327 3L 2460988..2461268 1..281 1405 100 Plus
Blast to na_te.dros performed 2014-11-26 20:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2451 976..1120 147 60.1 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 647..723 830..753 117 62.8 Minus

AT15596.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:20:04 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2462556..2464070 282..1796 96   Plus
chr3L 2460487..2460767 1..281 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:02 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
CG32306-RA 1..1428 101..1528 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:32:34 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
CG42669-RA 1..1428 101..1528 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:55:22 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
CG42669-RA 1..1428 101..1528 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:20:04 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
CG45186-RA 1..1428 101..1528 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-22 10:04:29 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
CG32306-RA 11..1806 1..1796 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:32:34 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
CG42669-RA 11..1806 1..1796 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:55:22 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
CG42669-RA 11..1806 1..1796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:20:04 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
CG45186-RA 11..1806 1..1796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:20:04 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2463057..2464571 282..1796 100   Plus
3L 2460988..2461268 1..281 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:55:22 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2463057..2464571 282..1796 100   Plus
arm_3L 2460988..2461268 1..281 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:17:04 Download gff for AT15596.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2463057..2464571 282..1796 100   Plus
3L 2460988..2461268 1..281 100 -> Plus

AT15596.pep Sequence

Translation from 100 to 1527

> AT15596.pep
MPTTIKRHSTTIVIKSSISGTTNSRQSPPASSAEVSSSAADNSMHSDERS
TPNATIDAEFEPSSLSLAERLAFFSNLCESGGGGGSTSAGGRYRSRTSSY
SRSPPGDRTTPRSSTTASSVSMTPTPMDYSPIPHDKEPSSLTLESIIEPE
QEEVKEQVDQDEVKLRKKEPVQRESSQHNGFHVLTRSATEPPSSTSPLRI
SIRTVGKLVLPDTFRGDRNNNSSSRSGSNSWSNTCMVKLQSLEPVSLSVH
SRTIGKVKSPFIEKQQEKPHTEKLANGTSDSGSDSGKENCASNEQEHLQH
QQSQDEDRAPPRVSEMRRKISRLVQQQQPQPQPVNRRHTTEITSVTVGTR
SPSVDDRFAKYFGVKESCNSTTTVHKTQSLPPSQVEATNAHVKLPQITTV
VSKRRELLKRTRPLSMDHYSSGCTSPTAMPSPKRAHSPVGRRKAAISSIE
DIEVTPDELRAAGRNFKLLYGELLG*

AT15596.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24919-PA 2235 GF24919-PA 1772..2235 20..475 1261 63.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14864-PA 2228 GG14864-PA 1768..2228 20..475 1798 89.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15727-PA 2393 GH15727-PA 2001..2392 178..475 589 42.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG45186-PA 475 CG45186-PA 1..475 1..475 2424 100 Plus
CG45186-PU 1519 CG45186-PU 1063..1519 19..475 2334 99.8 Plus
CG45186-PT 1877 CG45186-PT 1421..1877 19..475 2334 99.8 Plus
CG45186-PR 1702 CG45186-PR 1246..1702 19..475 2334 99.8 Plus
CG45186-PQ 1877 CG45186-PQ 1421..1877 19..475 2334 99.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12783-PA 2322 GI12783-PA 1815..2321 42..475 656 40.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24661-PA 447 GL24661-PA 26..446 16..474 826 51.1 Plus
Dper\GL16360-PA 201 GL16360-PA 82..200 359..474 377 63.9 Plus
Dper\GL16354-PA 245 GL16354-PA 126..244 359..474 370 63 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16820-PA 2137 GA16820-PA 1669..2136 16..474 926 54.5 Plus
Dpse\GA27727-PA 418 GA27727-PA 299..417 359..474 370 63 Plus
Dpse\GA23345-PA 219 GA23345-PA 100..218 359..474 363 62.2 Plus
Dpse\GA27727-PA 418 GA27727-PA 136..240 359..470 327 58.9 Plus
Dpse\GA23344-PA 99 GA23344-PA 1..98 380..474 297 62.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14491-PA 2206 GM14491-PA 1750..2206 19..475 1891 94.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13687-PA 2183 GD13687-PA 1744..2183 19..475 1787 91.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16082-PA 2229 GJ16082-PA 1762..2228 24..475 843 46.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12646-PA 2255 GK12646-PA 1761..2251 8..472 714 45.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20320-PA 2257 GE20320-PA 1800..2257 20..475 1748 90 Plus

AT15596.hyp Sequence

Translation from 100 to 1527

> AT15596.hyp
MPTTIKRHSTTIVIKSSISGTTNSRQSPPASSAEVSSSAADNSMHSDERS
TPNATIDAEFEPSSLSLAERLAFFSNLCESGGGGGSTSAGGRYRSRTSSY
SRSPPGDRTTPRSSTTASSVSMTPTPMDYSPIPHDKEPSSLTLESIIEPE
QEEVKEQVDQDEVKLRKKEPVQRESSQHNGFHVLTRSATEPPSSTSPLRI
SIRTVGKLVLPDTFRGDRNNNSSSRSGSNSWSNTCMVKLQSLEPVSLSVH
SRTIGKVKSPFIEKQQEKPHTEKLANGTSDSGSDSGKENCASNEQEHLQH
QQSQDEDRAPPRVSEMRRKISRLVQQQQPQPQPVNRRHTTEITSVTVGTR
SPSVDDRFAKYFGVKESCNSTTTVHKTQSLPPSQVEATNAHVKLPQITTV
VSKRRELLKRTRPLSMDHYSSGCTSPTAMPSPKRAHSPVGRRKAAISSIE
DIEVTPDELRAAGRNFKLLYGELLG*

AT15596.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG45186-PA 475 CG45186-PA 1..475 1..475 2424 100 Plus
CG45186-PU 1519 CG45186-PU 1063..1519 19..475 2334 99.8 Plus
CG45186-PT 1877 CG45186-PT 1421..1877 19..475 2334 99.8 Plus
CG45186-PR 1702 CG45186-PR 1246..1702 19..475 2334 99.8 Plus
CG45186-PQ 1877 CG45186-PQ 1421..1877 19..475 2334 99.8 Plus