Clone AT20328 Report

Search the DGRC for AT20328

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:203
Well:28
Vector:pOTB7
Associated Gene/TranscriptCG4390-RB
Protein status:AT20328.pep: gold
Sequenced Size:1154

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4390-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

AT20328.complete Sequence

1154 bp assembled on 2009-07-30

GenBank Submission: BT088985.1

> AT20328.complete
CAAACGTCAAGCAATACTCGATCGAAATCACAAAGTTATTGCAGCTCCCT
TGGGAATGGGAAGAAATTTCCTTCGTCTGCCCAGTGTGAGTGGTAGAAGC
TCATTCGTATATTCCATAGTCGCCTGTTCAAATCTTCCCAAGCGACGGAG
CATTGTGCTCAGTTTTGGCCACATTATGACCGAGAACATGACGCTCGAAC
AGCTGTCCGCAAATAAGTGCTTCGAGGGCGAGCAACGCGTGTATCGCCAT
CGCTCGGACACCTTGAAGTGCGACATGACCTTTGGCGTCTTCCTGCCGCC
GGCCGCTTTGGAGGGTAAACCGTGTCCGGTGCTGTTCTTCCTCAGCGGAC
TGACCTGCACGCATGAGAACTTCATCCAGAAGAGCGGATTCCAGCAGCAC
GCCGCCCGCCACAACCTGATCGTCGTCAATCCGGACACTTCGCCCAGGGG
CGTGGAAATTGCCGGCCAAGATGATGCATACGACTTTGGAAGCGGGGCTG
GATTCTATGTGGATGCAAAGGAGGAGCCGTGGTCGAAGCACTACAAGATG
TACAGCTATGTGACCCAGGAGCTGGTGGATGTGGTCAATGCCAATCTGCC
CGTGGTTCCCGGTAAACGCGGTATATTCGGCCACAGTATGGGCGGCCACG
GAGCCCTGATCTGCGCGCTTAAGAATCCCGGGCTGTACCAGTCGGTGTCC
GCTTTTGCGCCGATTGCCAATCCCACCGAGTGCCCGTGGGGCAAGAAGGC
CTTTGCCGGCTATCTGGGCTCCAATCCGGATGACTGGGCCCTGTGGGATG
CCACGCATCTGGTGTCGCAGTACGAGAGCACTCCGCAGGAGCTCTTCATC
GACCAAGGTGCAGCAGACAACTTCCTGGCCGGCAAGCAGCTGCTGCCGGA
GAACCTGCTGGCTGCCGCAGATGGCAACGATCACATCCAGACCATCTTCA
AGCAGCGCGAGGGATACGATCACAGCTACTTCTACATCGCCACGTTCGTC
GCCGAACACATCGCCTACCATGCCGCCCTGCTCACAGCTTCCGCTTGATG
ATATTCCGCTTGTACATAATCGTTGGTTTCCACCGAAACCATAATTCAAC
GTAAATTTGGCAGTAAATAAACAAATTTCGACGGAGAAAAAAAAAAAAAA
AAAA

AT20328.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390.a 1231 CG4390.a 17..1152 1..1136 5635 99.7 Plus
CG4390-RB 1207 CG4390-RB 25..1160 1..1136 5635 99.7 Plus
CG4390-RA 1124 CG4390-RA 120..1071 185..1136 4715 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15880366..15881319 1136..183 4680 99.4 Minus
chr3R 27901430 chr3R 15883510..15883690 184..4 905 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-RB 993 CG4390-PB 1..993 56..1048 4950 99.9 Plus
CG4390-RA 861 CG4390-PA 1..861 188..1048 4290 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:54:43 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-RB 1141 CG4390-RB 1..1136 1..1136 5635 99.7 Plus
CG4390-RA 1006 CG4390-RA 50..1001 185..1136 4715 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-PB 330 CG4390-PB 1..319 56..1012 1711 100 Plus
CG4390-PA 286 CG4390-PA 1..275 188..1012 1489 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20056423..20057376 1136..183 4725 99.7 Minus
3R 32079331 3R 20059567..20059750 184..1 920 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19797254..19798207 1136..183 4725 99.6 Minus
3R 31820162 3R 19800398..19800581 184..1 920 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:31:22 has no hits.

AT20328.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:31:27 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15883510..15883693 1..184 99   Minus
chr3R 15880366..15881317 185..1136 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:17 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 1..993 56..1048 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:53:10 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 1..993 56..1048 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:42 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 1..993 56..1048 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:27 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 1..993 56..1048 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-30 14:57:00 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 16..1151 1..1136 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:53:10 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 16..1151 1..1136 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:42 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 16..1151 1..1136 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:27 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 1..1136 1..1136 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:31:27 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20059567..20059750 1..184 100   Minus
3R 20056423..20057374 185..1136 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:42 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15885289..15885472 1..184 100   Minus
arm_3R 15882145..15883096 185..1136 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:44:03 Download gff for AT20328.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19800398..19800581 1..184 100   Minus
3R 19797254..19798205 185..1136 99 <- Minus

AT20328.pep Sequence

Translation from 1 to 1047

> AT20328.pep
KRQAILDRNHKVIAAPLGMGRNFLRLPSVSGRSSFVYSIVACSNLPKRRS
IVLSFGHIMTENMTLEQLSANKCFEGEQRVYRHRSDTLKCDMTFGVFLPP
AALEGKPCPVLFFLSGLTCTHENFIQKSGFQQHAARHNLIVVNPDTSPRG
VEIAGQDDAYDFGSGAGFYVDAKEEPWSKHYKMYSYVTQELVDVVNANLP
VVPGKRGIFGHSMGGHGALICALKNPGLYQSVSAFAPIANPTECPWGKKA
FAGYLGSNPDDWALWDATHLVSQYESTPQELFIDQGAADNFLAGKQLLPE
NLLAAADGNDHIQTIFKQREGYDHSYFYIATFVAEHIAYHAALLTASA*

AT20328.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17336-PA 327 GF17336-PA 1..327 19..347 1443 82.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15619-PA 330 GG15619-PA 1..330 19..348 1724 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23926-PA 285 GH23926-PA 1..285 63..346 1306 83.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-PB 330 CG4390-PB 1..330 19..348 1763 100 Plus
CG4390-PA 286 CG4390-PA 1..286 63..348 1541 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10052-PA 285 GI10052-PA 1..285 63..346 1292 82.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12516-PA 338 GL12516-PA 16..336 24..347 1394 79.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27533-PA 338 GA27533-PA 16..336 24..347 1397 79.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17704-PA 328 GM17704-PA 1..328 19..346 1758 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20081-PA 328 GD20081-PA 1..328 19..346 1765 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23787-PA 285 GJ23787-PA 1..285 63..346 1256 80 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22793-PA 285 GK22793-PA 1..285 63..346 1330 83.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25088-PA 330 GE25088-PA 1..330 19..348 1731 96.7 Plus

AT20328.hyp Sequence

Translation from 1 to 1047

> AT20328.hyp
KRQAILDRNHKVIAAPLGMGRNFLRLPSVSGRSSFVYSIVACSNLPKRRS
IVLSFGHIMTENMTLEQLSANKCFEGEQRVYRHRSDTLKCDMTFGVFLPP
AALEGKPCPVLFFLSGLTCTHENFIQKSGFQQHAARHNLIVVNPDTSPRG
VEIAGQDDAYDFGSGAGFYVDAKEEPWSKHYKMYSYVTQELVDVVNANLP
VVPGKRGIFGHSMGGHGALICALKNPGLYQSVSAFAPIANPTECPWGKKA
FAGYLGSNPDDWALWDATHLVSQYESTPQELFIDQGAADNFLAGKQLLPE
NLLAAADGNDHIQTIFKQREGYDHSYFYIATFVAEHIAYHAALLTASA*

AT20328.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-PB 330 CG4390-PB 1..330 19..348 1763 100 Plus
CG4390-PA 286 CG4390-PA 1..286 63..348 1541 100 Plus