Clone AT21608 Report

Search the DGRC for AT21608

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:216
Well:8
Vector:pOTB7
Associated Gene/TranscriptOptix-RB
Protein status:AT21608.pep: gold
Preliminary Size:2325
Sequenced Size:1406

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18455 2003-02-13 Blastp of sequenced clone
Optix 2008-04-29 Release 5.5 accounting
Optix 2008-08-15 Release 5.9 accounting
Optix 2008-12-18 5.12 accounting

Clone Sequence Records

AT21608.complete Sequence

1406 bp (1406 high quality bases) assembled on 2003-02-13

GenBank Submission: BT003802

> AT21608.complete
TAATGTGGAATTTACACATTGCAAGAGCATTGCTAGCTCGATAAATAAGC
ATCCAGCATAGCCAGAACAGCTCGGGAATGGGCTGTCGGAGCCGGCGGGC
GGACGGAGCTGCCTCACCAACGCCGTCGGACAGCTCCGACTCGGACATCT
CACTGGGCACCCACTCGCCGGTGCCGAGCAGCCTGCAGCTGCAGCATAGT
CCGGGCAGCACCTCCAACGGCGCCAACGACCGCGAGGAGAGCCTGAGCGT
GGACGACGACAAGCCGCGGGATCTGAGCGGATCGCTGCCACTGCCCCTCT
CGCTGCCCCTGCCGCTGGCCTCGCCCACCCACACGCCGCCCCAACTGCCG
CCGGGCTACGGGGGCGGGGCGGGCGCAGGACCCGGAGGACCTCTGACCGG
TCCGGGCTGTCTGCCACCCTTCAAGCTGGACGCGGCCACCAGTCTGTTCA
GCGCCGGCTGTTACCTGCAGAGCTTCAGCAACCTGAAGGAGATGTCGCAG
CAGTTTCCCATCCAGCCGATTGTCCTGCGTCCGCATCCGCAGCTGCCGCA
GTCGCTGGCACTGAACGGCGCATCCGGCGGACCGCCACTGCATCACCCGG
CCTACGCGGCTGCCTACAGTGTGGAGTGCGTTCCAGGTGGTCATGGACCA
CCGCATCCGCCGCCGAAGCTGAGGATAAACTCCCCGGAGAAGCTCAACTC
CACGGCAGTGGCGGCGGCAGCATCCGTCGGAGGAGGAGGTGGCAACCAAC
ACCATGAGCCCACCACGACCGGCTACCATCACAGTGGCCAACTGATGCTG
CATCGGCCCTTCTCCACGTCGCCGGAGCTGAAGCACAGTGCTCCCGAGAT
CACATGATATCAGCGGGTCTGAGGTGTCCACCTGTAACCCCACCCAGACT
AACCCAACAACCCCAAACCGAAATCCCAAATCCCAATCCTCACAAGCTCC
GAAGCACTAAGGCCCAGCTATTCAGATTGTTTCAATTGTATTTCTAAGTT
AGCCCGTAGTTAAGCGCATCCCAGCGGCGGAGTTCGAGCAATATTCGAAC
CGGAACTGTTTCCTATATCATGGCCCATAATTACCATACCTTTACCTATA
CCTCTACCTATACCGTTATCCAGCAGCAGCAAATCGCAAGCGTCGCACAC
TCACTCTTCAAAGATAGCCATTTAAGCCGGATGGAAACTGAGATACAGAT
TTAGAGCTAATACAGATAGCGGTCCCAGTGGCCCCAAAACTGAAATTGAA
TTCGAGACGTTTTCATTCTAATTTTGTGTGTGTGTACGTATTTGTAAATA
GAGTTTAAGTATGCAAATCATAGAGCTTACGTATACAATTAGATTGCAAT
AAAACCGAATGAACAGTTAAGAATTTGAATCATTAAAAAAAAAAAAAAAA
AAAAAA

AT21608.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
Optix-RB 1477 Optix-RB 85..1477 1..1393 6845 99.4 Plus
Optix.a 2742 Optix.a 1366..2710 49..1393 6605 99.4 Plus
Optix-RA 2357 Optix-RA 981..2325 49..1393 6605 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3928597..3929933 48..1384 6670 99.9 Plus
chr2R 21145070 chr2R 3928474..3928522 1..49 245 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Optix-RC 1479 CG18455-PC 656..1479 49..872 4090 99.8 Plus
Optix-RA 1464 CG18455-PA 656..1464 49..857 4015 99.8 Plus
Optix-RB 780 CG18455-PB 1..780 78..857 3870 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:55:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Optix-RB 1470 CG18455-RB 85..1468 1..1384 6830 99.6 Plus
Optix-RC 2668 CG18455-RC 1331..2666 49..1384 6590 99.6 Plus
Optix-RA 2358 CG18455-RA 1021..2356 49..1384 6590 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Optix-PC 492 CG18455-PC 220..492 51..869 886 99.6 Plus
Optix-PA 487 CG18455-PA 220..487 51..854 869 100 Plus
Optix-PB 259 CG18455-PB 1..259 78..854 823 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8041191..8042536 48..1393 6610 99.4 Plus
2R 25286936 2R 8041068..8041116 1..49 245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8042390..8043735 48..1393 6610 99.4 Plus
2R 25260384 2R 8042267..8042315 1..49 245 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:29:56 has no hits.

AT21608.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:48:04 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3928599..3929933 50..1384 97   Plus
chr2R 3928474..3928522 1..49 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:16:42 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
Optix-RA 652..1464 44..857 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:52:47 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
Optix-RA 652..1464 44..857 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:51 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
Optix-RC 652..1479 44..872 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:43:55 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
Optix-RA 652..1464 44..857 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:48:04 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
Optix-RC 652..1479 44..872 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:06:57 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
Optix-RB 2..1385 1..1384 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:52:47 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
Optix-RB 2..1385 1..1384 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:51 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
Optix-RB 85..1468 1..1384 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:43:56 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
Optix-RB 2..1385 1..1384 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:48:04 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
Optix-RB 85..1468 1..1384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:48:04 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8041193..8042527 50..1384 99   Plus
2R 8041068..8041116 1..49 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:51 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3928698..3930032 50..1384 99   Plus
arm_2R 3928573..3928621 1..49 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:14:44 Download gff for AT21608.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8042392..8043726 50..1384 99   Plus
2R 8042267..8042315 1..49 100 -> Plus

AT21608.pep Sequence

Translation from 77 to 856

> AT21608.pep
MGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSSLQLQHSPGSTSNGAN
DREESLSVDDDKPRDLSGSLPLPLSLPLPLASPTHTPPQLPPGYGGGAGA
GPGGPLTGPGCLPPFKLDAATSLFSAGCYLQSFSNLKEMSQQFPIQPIVL
RPHPQLPQSLALNGASGGPPLHHPAYAAAYSVECVPGGHGPPHPPPKLRI
NSPEKLNSTAVAAAASVGGGGGNQHHEPTTTGYHHSGQLMLHRPFSTSPE
LKHSAPEIT*

AT21608.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 22:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13656-PA 489 GF13656-PA 231..489 1..259 881 85.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 22:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23326-PA 490 GG23326-PA 229..490 1..259 901 93.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 22:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21899-PA 474 GH21899-PA 229..474 1..259 735 74.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 22:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
Optix-PB 259 CG18455-PB 1..259 1..259 1397 100 Plus
Optix-PA 487 CG18455-PA 229..487 1..259 1397 100 Plus
Optix-PC 492 CG18455-PC 229..487 1..259 1397 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 22:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19347-PA 501 GI19347-PA 229..501 1..259 681 64.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 22:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11483-PA 493 GL11483-PA 228..493 1..259 607 63 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 22:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14941-PA 492 GA14941-PA 228..492 1..259 770 79 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 22:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21001-PA 487 GM21001-PA 229..487 1..259 1312 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 22:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10534-PA 199 GD10534-PA 50..199 110..259 607 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 22:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22125-PA 481 GJ22125-PA 229..481 1..259 774 75.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 22:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23166-PA 490 GK23166-PA 231..490 1..259 741 68.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 22:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19170-PA 492 GE19170-PA 229..492 1..259 889 91.7 Plus

AT21608.hyp Sequence

Translation from 77 to 856

> AT21608.hyp
MGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSSLQLQHSPGSTSNGAN
DREESLSVDDDKPRDLSGSLPLPLSLPLPLASPTHTPPQLPPGYGGGAGA
GPGGPLTGPGCLPPFKLDAATSLFSAGCYLQSFSNLKEMSQQFPIQPIVL
RPHPQLPQSLALNGASGGPPLHHPAYAAAYSVECVPGGHGPPHPPPKLRI
NSPEKLNSTAVAAAASVGGGGGNQHHEPTTTGYHHSGQLMLHRPFSTSPE
LKHSAPEIT*

AT21608.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Optix-PB 259 CG18455-PB 1..259 1..259 1397 100 Plus
Optix-PA 487 CG18455-PA 229..487 1..259 1397 100 Plus
Optix-PC 492 CG18455-PC 229..487 1..259 1397 100 Plus