Clone AT24528 Report

Search the DGRC for AT24528

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:245
Well:28
Vector:pOTB7
Associated Gene/TranscriptTER94-RC
Protein status:AT24528.pep: gold
Sequenced Size:2993

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
TER94-RC 2009-06-22 Replacement based on scoring

Clone Sequence Records

AT24528.complete Sequence

2993 bp assembled on 2009-11-01

GenBank Submission: BT100202.1

> AT24528.complete
GAACGATAAGATGGATCATGATGGGGATACGAGGGACTTTATGCGGGGAT
ATCACAGCGAGCAGGATGAGAAAATGAAGCCGAAAGACTCGTTCGATAAG
CGTGAAGATCTGGCTACGGCGATCCTGAAGCGCAAGGACCGTCCCAACCG
ACTGATTGTGGAAGAGGCGCAGAATGACGACAACTCTGTGGTGTCGCTAT
CGCAGGCGAAGATGGATGAGCTGCAGCTCTTCCGTGGCGACACCGTGATT
CTGAAGGGCAAGCGCCGAAAGGAGACGGTGTGCATCGTGCTCTCGGACGA
CACCTGTCCCGACGAGAAGATCCGCATGAACCGCGTGGTGCGCAACAACC
TGTGCGTCCATCTTTCAGATGTGGTTTCCGTGCAGTCCTGCCCGGACGTC
AAGTACGGCAAACGGGTGCGCATCCTGCCCATCGACGAAAGCACCGAAGG
CGTTACCGGCAACCTGTTCGAGATCTATCTGAAGCCGTACTTCCTAGAGG
CCTATCGGCCAATCCACATGGGCGACAACTTTATTGTGCGCGCCGCCATG
CGTCCTATTGAGTTCAAGGTGGTGCTGACCGACCCGGAGCCCTACTGCAT
CGTAGCTCCCGAGACTGTAATCTTCTGCGACGGTGATCCAATCAAGCGCG
AGGAGGAGGAGGAGTCCCTAAACGCCGTTGGCTACGATGATATCGGTGGT
TGCCGCAAGCAGCTGGCCCAGATCAAGGAGATGGTTGAGTTGCCTTTGCG
GCATCCATCGCTCTTCAAGGCCATTGGTGTGAAGCCACCGCGTGGTATTC
TTATGTACGGTCCCCCGGGTACCGGTAAGACCCTGATTGCCAGGGCTGTG
GCCAACGAGACCGGAGCCTTTTTCTTCCTGATTAACGGACCGGAGATCAT
GTCCAAACTGGCCGGAGAGTCGGAATCGAATCTGCGTAAGGCCTTCGAGG
AAGCCGAGAAAAACTCGCCGGCTATCATCTTCATCGATGAGATCGACGCT
ATTGCCCCCAAGCGTGACAAGACCCACGGTGAGGTGGAGCGTCGCATTGT
GTCGCAGCTTTTGACCCTGATGGATGGCATGAAGAAGAGCTCCCATCTGA
TCGTTATGGCTGCTACCAACAGGCCCAACTCCATTGACCCGGCCCTGCGT
CGCTTTGGACGTTTTGATCGTGAGATTGACATCGGCATTCCAGATGCCAC
TGGTCGGCTGGAGGTGCTGCGCATTCACACCAAGAACATGAAGCTGCATG
ATGATGTTGACCTGGAGCAGATTGCTGCCGAATCCCACGGACATGTGGGC
GCTGATCTGGCTTCACTCTGCTCTGAGGCTGCCCTTCAGCAAATCCGTGA
GAAGATGGACCTCATCGATTTGGAAGACGATAAGATCGATGCCGAGGTGC
TGGCGTCGCTGGCCGTGACAATGGAGAACTTCCGCTACGCTATGACCAAG
TCCAGTCCATCGGCGCTGCGTGAAACTGTTGTTGAGGTGCCCAACACCAC
CTGGACAGACATCGGCGGTCTGGAGAGCGTCAAGAAGGAATTGCAGGAGC
TGGTGCAATACCCAGTGGAGCATCCGGACAAGTTCTTGAAGTTTGGCATG
CAGCCCAGTCGCGGTGTCCTTTTCTACGGACCCCCTGGTTGCGGTAAGAC
GCTGCTGGCCAAGGCCATTGCCAACGAGTGCCAGGCGAACTTCATCTCAG
TCAAGGGTCCCGAGCTGCTGACCATGTGGTTCGGCGAGTCTGAGGCCAAC
GTGCGCGACATCTTCGATAAGGCTCGCTCGGCGGCTCCTTGTGTGCTCTT
CTTTGACGAGCTGGACTCGATCGCCAAAGCCCGTGGCGGTAATGTCGGCG
ATGCTGGCGGCGCCGCTGATCGTGTGATCAATCAGATCCTTACCGAAATG
GATGGCATGGGAGCCAAGAAGAATGTGTTCATCATCGGAGCCACCAATCG
CCCGGACATTATCGATCCGGCCATCCTCCGTCCGGGCCGTCTGGATCAGT
TGATCTATATTCCGCTGCCCGACGACAAATCGCGTGAGGCTATCCTGAAG
GCTAACTTGCGCAAGTCGCCGCTGGCCAAGGAAGTAGACCTTACCTACAT
CGCCAAGGTGACGCAGGGCTTCTCTGGCGCCGATCTGACCGAGATCTGCC
AGCGGGCTTGCAAGCTGGCCATCCGACAGGCCATCGAGGCTGAAATTCGT
CGCGAGAAGGAGCGCGCCGAAAATCAGAACTCCGCGATGGACATGGACGA
GGACGATCCAGTGCCGGAGATTACCAGCGCCCACTTCGAGGAGGCCATGA
AGTTCGCTCGCCGTTCGGTGTCCGATAATGACATCAGGAAGTACGAGATG
TTTGCCCAGACTTTGCAGCAGTCCCGTGGATTCGGACAGAACTTCAGATT
CCCCGGTCAAACCGGCAACACCTCAGGATCTGGTAACAACTTGCCAGTTA
ACTCGCCCGGCGACAACGGCGACGATGATCTTTACAGTTAGATTTCTAGT
TTTACACCGCAAAACAAAACCACAAAATGGAACTTTTTAAATGAATTTTT
TCCGTAAAACCGAGCAAGCAAAACCAATCACATTCGCATCCTGGACGCGG
TAACTTACTACAGCAACCATTGGCTAAGACATCCAGCCGATGGCGAAATC
AGATGACATACCCGATTCAATATTCACTTCTTTGATACCATCCTTACTCT
TGGTCGCGGATACGTGCAGTAGGAGAAGGTTCCCATTTGGATTTGGGCTC
GCCTAATCCGAAACCATTTTAATTGGCGAACTATTCCGCGCCTCACACTA
ATCATTCGTGCATTGTCGGTAGAGTGGCTCCGATATATGAGTTTCTATAA
ACATAATTATTAACGATACACATACACACATACATTTAAAGATAAATACA
TATATTAAACACCGTAAAATTATAAGTGTATTTGGAGCTACATTTTTAAG
TGAATAAAAATTATAAATTCAACAAAAAAAAAAAAAAAAAAAA

AT24528.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
TER94-RC 3075 TER94-RC 86..3062 1..2977 14750 99.6 Plus
TER94-RA 3259 TER94-RA 279..3158 98..2977 14250 99.6 Plus
TER94-RD 3129 TER94-RD 255..3129 103..2977 14240 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5878165..5880204 203..2242 10170 99.9 Plus
chr2R 21145070 chr2R 5880489..5881067 2395..2973 2895 100 Plus
chr2R 21145070 chr2R 5880271..5880425 2243..2397 760 99.4 Plus
chr2R 21145070 chr2R 5877978..5878082 102..206 525 100 Plus
chr2R 21145070 chr2R 5877796..5877897 1..102 510 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
TER94-RC 2481 CG2331-PC 1..2481 11..2491 12270 99.6 Plus
TER94-RE 2478 CG2331-PE 1..2478 11..2491 12190 99.5 Plus
TER94-RA 2406 CG2331-PA 13..2406 98..2491 11820 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
TER94-RC 3058 CG2331-RC 86..3058 1..2973 14730 99.7 Plus
TER94-RE 3055 CG2331-RE 86..3055 1..2973 14650 99.6 Plus
TER94-RA 3016 CG2331-RA 141..3016 98..2973 14230 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
TER94-PC 826 CG2331-PC 1..826 11..2488 3924 100 Plus
TER94-PE 825 CG2331-PE 1..825 11..2488 3907 99.9 Plus
TER94-PA 801 CG2331-PA 5..801 98..2488 3753 99.9 Plus
TER94-PD 759 CG2331-PD 1..759 212..2488 3577 100 Plus
CG5776-PB 799 CG5776-PB 255..754 635..2158 890 36.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9990657..9992696 203..2242 10080 99.6 Plus
2R 25286936 2R 9992981..9993563 2395..2977 2915 100 Plus
2R 25286936 2R 9992763..9992917 2243..2397 760 99.4 Plus
2R 25286936 2R 9990470..9990574 102..206 525 100 Plus
2R 25286936 2R 9990288..9990389 1..102 510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9991856..9993895 203..2242 10080 99.6 Plus
2R 25260384 2R 9994180..9994762 2395..2977 2915 100 Plus
2R 25260384 2R 9993962..9994116 2243..2397 760 99.3 Plus
2R 25260384 2R 9991669..9991773 102..206 525 100 Plus
2R 25260384 2R 9991487..9991588 1..102 510 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:41:29 has no hits.

AT24528.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:58:09 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5880492..5881067 2398..2973 100   Plus
chr2R 5880271..5880425 2243..2397 99 -> Plus
chr2R 5878168..5880204 206..2242 99 -> Plus
chr2R 5877979..5878081 103..205 100 -> Plus
chr2R 5877796..5877897 1..102 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-01 09:32:44 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 1..2481 11..2491 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:15:24 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 1..2481 11..2491 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:28:34 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 1..2481 11..2491 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:58:09 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 1..2481 11..2491 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-01 09:32:44 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 1..2963 11..2973 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:15:23 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 1..2963 11..2973 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:28:34 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 86..3058 1..2973 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:58:09 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 86..3058 1..2973 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:58:09 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9992984..9993559 2398..2973 100   Plus
2R 9992763..9992917 2243..2397 99 -> Plus
2R 9990660..9992696 206..2242 99 -> Plus
2R 9990471..9990573 103..205 100 -> Plus
2R 9990288..9990389 1..102 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:28:34 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5880489..5881064 2398..2973 100   Plus
arm_2R 5880268..5880422 2243..2397 99 -> Plus
arm_2R 5878165..5880201 206..2242 99 -> Plus
arm_2R 5877976..5878078 103..205 100 -> Plus
arm_2R 5877793..5877894 1..102 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:05:28 Download gff for AT24528.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9994183..9994758 2398..2973 100   Plus
2R 9993962..9994116 2243..2397 99 -> Plus
2R 9991859..9993895 206..2242 99 -> Plus
2R 9991670..9991772 103..205 100 -> Plus
2R 9991487..9991588 1..102 100 -> Plus

AT24528.pep Sequence

Translation from 1 to 2490

> AT24528.pep
NDKMDHDGDTRDFMRGYHSEQDEKMKPKDSFDKREDLATAILKRKDRPNR
LIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSDD
TCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEG
VTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCI
VAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLR
HPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGAFFFLINGPEIM
SKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIV
SQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDAT
GRLEVLRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIRE
KMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTT
WTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKT
LLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLF
FDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNR
PDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYI
AKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDE
DDPVPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQNFRF
PGQTGNTSGSGNNLPVNSPGDNGDDDLYS*

AT24528.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11135-PA 801 GF11135-PA 5..801 33..829 4188 98.5 Plus
Dana\GF15657-PA 796 GF15657-PA 260..764 217..731 971 37.3 Plus
Dana\GF10639-PA 972 GF10639-PA 657..965 469..792 716 45 Plus
Dana\GF24207-PA 716 GF24207-PA 219..706 263..752 707 34.1 Plus
Dana\GF13781-PA 895 GF13781-PA 362..846 266..732 687 34.3 Plus
Dana\GF10639-PA 972 GF10639-PA 689..945 228..487 516 41.5 Plus
Dana\GF10639-PA 972 GF10639-PA 258..511 500..754 451 35.5 Plus
Dana\GF24207-PA 716 GF24207-PA 447..685 227..458 450 37.7 Plus
Dana\GF10639-PA 972 GF10639-PA 259..486 228..452 442 39.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\TER94-PA 801 GG24127-PA 5..801 33..829 4203 99 Plus
Dere\GG10242-PA 799 GG10242-PA 258..766 215..731 982 36 Plus
Dere\GG14421-PA 935 GG14421-PA 620..918 469..782 718 46.4 Plus
Dere\GG20154-PA 897 GG20154-PA 364..848 266..732 684 34.1 Plus
Dere\GG15137-PA 723 GG15137-PA 219..681 263..730 679 34.6 Plus
Dere\GG14421-PA 935 GG14421-PA 652..908 228..487 525 41.5 Plus
Dere\GG10242-PA 799 GG10242-PA 532..769 226..458 516 41.6 Plus
Dere\GG14421-PA 935 GG14421-PA 246..471 228..451 453 40.1 Plus
Dere\GG14421-PA 935 GG14421-PA 237..500 494..756 451 35.3 Plus
Dere\GG15137-PA 723 GG15137-PA 447..701 227..471 443 38 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20288-PA 802 GH20288-PA 8..802 35..829 4161 98 Plus
Dgri\GH10120-PA 801 GH10120-PA 263..796 217..782 957 36.9 Plus
Dgri\GH14878-PA 957 GH14878-PA 642..950 469..792 727 45 Plus
Dgri\GH21180-PA 910 GH21180-PA 205..861 115..732 664 30.8 Plus
Dgri\GH11210-PA 731 GH11210-PA 221..685 263..719 639 31.6 Plus
Dgri\GH14878-PA 957 GH14878-PA 674..930 228..487 497 40 Plus
Dgri\GH14878-PA 957 GH14878-PA 250..487 216..451 467 39.7 Plus
Dgri\GH21180-PA 910 GH21180-PA 626..892 226..487 455 41.6 Plus
Dgri\GH14878-PA 957 GH14878-PA 251..513 490..753 444 35.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
TER94-PC 826 CG2331-PC 1..826 4..829 4254 100 Plus
TER94-PE 825 CG2331-PE 1..825 4..829 4237 99.9 Plus
TER94-PA 801 CG2331-PA 5..801 33..829 4083 99.9 Plus
TER94-PD 759 CG2331-PD 1..759 71..829 3907 100 Plus
CG5776-PB 799 CG5776-PB 255..766 212..731 974 37.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19458-PA 801 GI19458-PA 5..801 33..829 4180 98.4 Plus
Dmoj\GI14498-PA 802 GI14498-PA 278..801 231..786 965 36.3 Plus
Dmoj\GI12852-PA 307 GI12852-PA 9..300 486..792 707 47.1 Plus
Dmoj\GI18774-PA 906 GI18774-PA 372..853 266..728 680 35.2 Plus
Dmoj\GI14126-PA 730 GI14126-PA 218..726 263..785 578 29.3 Plus
Dmoj\GI12852-PA 307 GI12852-PA 24..280 228..487 490 39.2 Plus
Dmoj\GI18774-PA 906 GI18774-PA 622..850 226..449 457 45.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11509-PA 626 GL11509-PA 5..601 33..629 3133 98.7 Plus
Dper\GL19734-PA 797 GL19734-PA 269..791 230..782 937 35 Plus
Dper\GL26363-PA 909 GL26363-PA 594..902 469..792 694 45.6 Plus
Dper\GL20091-PA 895 GL20091-PA 362..846 266..732 674 33.5 Plus
Dper\GL25293-PA 1008 GL25293-PA 481..1000 265..794 607 30.1 Plus
Dper\GL11509-PA 626 GL11509-PA 200..425 501..729 489 41 Plus
Dper\GL26363-PA 909 GL26363-PA 626..882 228..487 452 39.2 Plus
Dper\GL20091-PA 895 GL20091-PA 611..877 226..487 450 40.4 Plus
Dper\GL26363-PA 909 GL26363-PA 231..483 500..753 444 35.3 Plus
Dper\GL26363-PA 909 GL26363-PA 232..459 228..452 439 40.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15351-PA 801 GA15351-PA 5..801 33..829 4190 98.5 Plus
Dpse\GA19119-PA 797 GA19119-PA 269..791 230..782 940 34.9 Plus
Dpse\GA21172-PA 933 GA21172-PA 618..926 469..792 702 45.9 Plus
Dpse\GA24927-PA 895 GA24927-PA 362..846 266..732 676 33.7 Plus
Dpse\GA11333-PA 729 GA11333-PA 223..729 263..789 598 29 Plus
Dpse\GA21172-PA 933 GA21172-PA 650..906 228..487 452 39.2 Plus
Dpse\GA24927-PA 895 GA24927-PA 611..877 226..487 451 40.8 Plus
Dpse\GA21172-PA 933 GA21172-PA 251..507 228..467 444 37.6 Plus
Dpse\GA21172-PA 933 GA21172-PA 250..501 500..752 439 34.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21173-PA 801 GM21173-PA 5..801 33..829 4225 99.7 Plus
Dsec\GM26020-PA 799 GM26020-PA 255..766 212..731 982 36.7 Plus
Dsec\GM14837-PA 944 GM14837-PA 629..927 469..782 715 46.1 Plus
Dsec\GM21243-PA 897 GM21243-PA 364..848 266..732 691 35.7 Plus
Dsec\GM14570-PA 717 GM14570-PA 220..707 263..752 651 32.4 Plus
Dsec\GM14837-PA 944 GM14837-PA 661..917 228..487 521 41.1 Plus
Dsec\GM26020-PA 799 GM26020-PA 532..769 226..458 508 41.2 Plus
Dsec\GM14837-PA 944 GM14837-PA 237..499 490..753 459 35.1 Plus
Dsec\GM21243-PA 897 GM21243-PA 613..879 226..487 458 41.3 Plus
Dsec\GM14837-PA 944 GM14837-PA 248..473 228..451 448 39.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:39:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10706-PA 801 GD10706-PA 5..801 33..829 4225 99.7 Plus
Dsim\GD22101-PA 799 GD22101-PA 255..766 212..731 977 36.7 Plus
Dsim\GD10761-PA 897 GD10761-PA 364..848 266..732 692 34.9 Plus
Dsim\GD13761-PA 717 GD13761-PA 220..713 263..785 642 31.3 Plus
Dsim\GD14479-PA 1006 GD14479-PA 479..998 265..794 613 29.7 Plus
Dsim\GD10761-PA 897 GD10761-PA 613..879 226..487 459 41.3 Plus
Dsim\GD13761-PA 717 GD13761-PA 448..686 227..458 431 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21209-PA 801 GJ21209-PA 5..801 33..829 4188 98.6 Plus
Dvir\GJ16276-PA 800 GJ16276-PA 273..797 231..784 969 35.7 Plus
Dvir\GJ12996-PA 933 GJ12996-PA 619..926 470..792 723 45.4 Plus
Dvir\GJ17760-PA 727 GJ17760-PA 218..723 263..785 623 29.8 Plus
Dvir\GJ21800-PA 256 GJ21800-PA 9..207 538..732 554 54.5 Plus
Dvir\GJ12996-PA 933 GJ12996-PA 650..906 228..487 494 39.2 Plus
Dvir\GJ16276-PA 800 GJ16276-PA 534..766 226..453 475 39.9 Plus
Dvir\GJ12996-PA 933 GJ12996-PA 238..475 216..451 468 40.2 Plus
Dvir\GJ17760-PA 727 GJ17760-PA 456..696 225..458 449 38.6 Plus
Dvir\GJ12996-PA 933 GJ12996-PA 249..501 500..753 438 35.8 Plus
Dvir\GJ16276-PA 800 GJ16276-PA 269..526 500..750 213 27 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21952-PA 801 GK21952-PA 5..801 33..829 4192 98.6 Plus
Dwil\GK14665-PA 794 GK14665-PA 267..792 231..786 984 35.8 Plus
Dwil\GK17377-PA 1001 GK17377-PA 678..980 469..786 721 45.5 Plus
Dwil\GK20636-PA 895 GK20636-PA 367..892 266..787 685 33.9 Plus
Dwil\GK20511-PA 713 GK20511-PA 221..678 266..730 644 32.5 Plus
Dwil\GK17377-PA 1001 GK17377-PA 710..966 228..487 488 39.6 Plus
Dwil\GK17377-PA 1001 GK17377-PA 287..556 490..760 457 35.3 Plus
Dwil\GK17377-PA 1001 GK17377-PA 298..516 228..444 450 40.9 Plus
Dwil\GK20636-PA 895 GK20636-PA 611..843 226..453 442 43 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19324-PA 801 GE19324-PA 5..801 33..829 4216 99.4 Plus
Dyak\GE12088-PA 799 GE12088-PA 272..766 229..731 977 37.5 Plus
Dyak\GE21612-PA 931 GE21612-PA 617..925 469..792 719 45.6 Plus
Dyak\GE12844-PA 897 GE12844-PA 364..848 266..732 683 34.5 Plus
Dyak\GE21362-PA 717 GE21362-PA 220..707 263..752 639 31.8 Plus
Dyak\GE21612-PA 931 GE21612-PA 649..905 228..487 520 41.1 Plus
Dyak\GE12088-PA 799 GE12088-PA 532..769 226..458 507 41.2 Plus
Dyak\GE12844-PA 897 GE12844-PA 613..879 226..487 458 41 Plus
Dyak\GE21612-PA 931 GE21612-PA 244..469 228..451 453 40.1 Plus
Dyak\GE21612-PA 931 GE21612-PA 235..498 494..756 451 35.3 Plus

AT24528.hyp Sequence

Translation from 1 to 2490

> AT24528.hyp
NDKMDHDGDTRDFMRGYHSEQDEKMKPKDSFDKREDLATAILKRKDRPNR
LIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSDD
TCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEG
VTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCI
VAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLR
HPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGAFFFLINGPEIM
SKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIV
SQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDAT
GRLEVLRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIRE
KMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTT
WTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKT
LLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLF
FDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNR
PDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYI
AKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDE
DDPVPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQNFRF
PGQTGNTSGSGNNLPVNSPGDNGDDDLYS*

AT24528.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
TER94-PC 826 CG2331-PC 1..826 4..829 4254 100 Plus
TER94-PE 825 CG2331-PE 1..825 4..829 4237 99.9 Plus
TER94-PA 801 CG2331-PA 5..801 33..829 4083 99.9 Plus
TER94-PD 759 CG2331-PD 1..759 71..829 3907 100 Plus
CG5776-PB 799 CG5776-PB 255..766 212..731 974 37.3 Plus