Clone AT29920 Report

Search the DGRC for AT29920

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:299
Well:20
Vector:pOTB7
Associated Gene/Transcriptsvp-RC
Protein status:AT29920.pep: gold
Preliminary Size:333
Sequenced Size:2085

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17738 2002-01-01 Sim4 clustering to Release 2
CG11502 2002-01-11 Blastp of sequenced clone
svp 2008-04-29 Release 5.5 accounting
svp 2008-08-15 Release 5.9 accounting
svp 2008-12-18 5.12 accounting

Clone Sequence Records

AT29920.complete Sequence

2085 bp (2085 high quality bases) assembled on 2002-01-11

GenBank Submission: AY075272

> AT29920.complete
CTAAATTGTTGTTTTCAAAAGAAATGAATTTCTTTCCACTCCTTTCAGAA
TTCAAGAATAAATATTGAAGCAATATGGCTTCCCTTGTTCAAACCGATCA
ATCGTTGCAAATCTTTCTTCAAGCGCTCGGTGCGACGTAATCTAACTTAC
TCTTGCCGCGGCAGCAGAAACTGTCCCATAGATCAACACCATCGCAATCA
ATGTCAATATTGTCGATTGAAGAAGTGCCTCAAAATGGGCATGAGACGCG
AAGCTGTTCAACGTGGACGCGTACCACCCACTCAGCCCGGTCTGGCCGGC
ATGCATGGGCAGTACCAGATTGCCAACGGGGATCCCATGGGCATTGCCGG
CTTTAACGGGCACTCGTACCTCAGTTCCTACATCTCGCTCCTGCTGCGGG
CGGAACCGTATCCGACTTCGCGATATGGCCAGTGCATGCAACCCAACAAC
ATTATGGGCATCGACAACATCTGCGAACTGGCCGCCCGACTGCTCTTCTC
GGCGGTCGAGTGGGCCAAGAACATACCCTTCTTCCCGGAGCTGCAGGTGA
CCGACCAGGTGGCCCTGCTCCGGCTCGTCTGGTCAGAGCTCTTCGTCCTA
AACGCCAGCCAGTGCTCCATGCCGCTCCATGTGGCGCCACTGCTGGCCGC
CGCCGGACTTCATGCCTCCCCGATGGCCGCCGATCGTGTGGTGGCCTTCA
TGGACCACATCCGCATCTTCCAGGAGCAGGTGGAGAAGCTGAAGGCGCTG
CATGTCGACTCCGCGGAGTACTCCTGCCTCAAGGCGATCGTGCTCTTCAC
CACCGATGCCTGCGGCCTGTCCGATGTGACGCACATTGAATCCCTGCAAG
AGAAGTCGCAGTGCGCCCTCGAGGAATACTGCCGGACCCAGTATCCCAAC
CAGCCCACGAGATTCGGCAAGCTGCTTCTCAGACTGCCATCGCTGCGAAC
GGTCTCCTCACAAGTCATTGAGCAATTGTTTTTTGTGCGTCTAGTCGGAA
AAACGCCAATTGAAACGCTGATACGCGATATGCTGCTGAGCGGCAACAGT
TTCTCCTGGCCCTATCTGCCTTCGATGTGACACACGATGTGGCGCCAATT
GACAACAACTTGATCATCGGCCGCAGCTGTGGCGGCTGCAACGCTCAACA
TCAATTCCGGCGGAGGCGGCATCGGCATCGGCGGCGGGGGCAGTGGCAGT
GGCGGTGGCGGTAGTGGAGGCGGTGGCGGAGTCGTTGGATGTGGCAGCCA
CAACGTTGTCGCTGCCAGTCATGACCAGCTCGCCAATGTTGCTGTCATGC
AGCAAACATACGGCAGCGGCGGCAGCAGCAGCAGCAGCATCAGCGGTTGC
CACAACGGTAACAACGGCAGCGGCGGCAGCATTTGCAATCAGCAGATCAA
CAACTACGGCAACAACAGCAACAACAATGTCGGCAATCATATGAGTGCAG
GCAGTTTTTTCGGTGGGTCCAACAACAGCATCCACAGTAGTGGCAATAGC
AATACCGATTATATGACCACGCCAGCCACCGCTTATGCGACACCAGCGAC
AGCAGCCACATCCACGGTGAACACCACAACGATGCTGTCTAATTACTGCG
ATGCCGCCACCATGATGATGGCCGCTGCTGCAGTCAATGCAAATCAATGC
CTGCAGCAACATCACCAGCGCATGTTGCTCGCGGGCAGCAGCAACAGCAG
CAGCAACAACAGCAGCAGCAACAGCAACGGCGCAGCAGCAATGCCCTCCT
CATCCTCGTCTGGCTCACTGTCATCTGCCTCATCGACCCCAACAGCAACA
GCAACTGCGACTGCAATTGCAACAGCAACAGCAACTGCAGCAGCAACAGC
CGCGCAGCAACAACAGCAACAATCGCCGCCAAATTTAATCGATATCAGCG
AAGTTCCTCTCATTGTGGATGTCAAGTAGTGTAATTATTTATGCATCTAG
AAATGGGGCTATAAACCAACCTTGTAGATACCCCGCCCCGCCCCCACCAC
TACCATAAAAACCATAAAACCCCAAAAAAAAAACAATTGAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT29920.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
svp-RC 3022 svp-RC 13..2070 1..2058 10230 99.8 Plus
svp-RB 4212 svp-RB 1286..3240 104..2058 9715 99.7 Plus
svp.a 4334 svp.a 1101..3055 104..2058 9715 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8126283..8127358 964..2039 5365 99.9 Plus
chr3R 27901430 chr3R 8119393..8119946 252..805 2770 100 Plus
chr3R 27901430 chr3R 8125876..8126036 805..965 805 100 Plus
chr3R 27901430 chr3R 8115596..8115745 104..253 750 100 Plus
chr3R 27901430 chr3R 8084139..8084243 1..105 525 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
svp-RE 1665 CG11502-PE 656..1665 104..1113 5050 100 Plus
svp-RB 1632 CG11502-PB 656..1632 104..1080 4885 100 Plus
svp-RC 846 CG11502-PC 1..846 235..1080 4230 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
svp-RC 2876 CG11502-RC 13..2051 1..2039 10180 100 Plus
svp-RE 3859 CG11502-RE 1099..3034 104..2039 9665 99.9 Plus
svp-RB 3859 CG11502-RB 1099..3034 104..2039 9665 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
svp-PE 554 CG11502-PE 220..551 106..1101 1685 99.7 Plus
svp-PB 543 CG11502-PB 220..543 106..1077 1646 100 Plus
svp-PC 281 CG11502-PC 1..281 235..1077 1397 100 Plus
svp-PA 746 CG11502-PA 220..452 106..804 1174 100 Plus
Hnf4-PF 666 CG9310-PF 124..432 106..1044 460 36.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12300885..12301979 964..2058 5415 99.6 Plus
3R 32079331 3R 12294006..12294559 252..805 2770 100 Plus
3R 32079331 3R 12300478..12300638 805..965 805 100 Plus
3R 32079331 3R 12290209..12290358 104..253 750 100 Plus
3R 32079331 3R 12258749..12258853 1..105 525 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12041716..12042810 964..2058 5415 99.6 Plus
3R 31820162 3R 12034837..12035390 252..805 2770 100 Plus
3R 31820162 3R 12041309..12041469 805..965 805 100 Plus
3R 31820162 3R 12031040..12031189 104..253 750 100 Plus
3R 31820162 3R 11999580..11999684 1..105 525 100 Plus
X 23527363 X 9063813..9063873 1850..1790 200 88.5 Minus
Blast to na_te.dros performed 2014-11-26 22:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2334..2939 1300..1869 445 58 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2305..2819 1321..1872 377 58.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..6950 1303..1562 312 63.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6746..7184 1314..1742 288 58 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6781..6916 1299..1436 252 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2485..2999 1309..1843 246 56.1 Plus
roo 9092 roo DM_ROO 9092bp 1049..1200 1324..1477 233 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6923 1353..1556 231 60.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2602..2973 1360..1742 221 56.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6821..6952 1300..1433 214 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..7091 1360..1731 206 54.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..7210 1369..1877 191 55.6 Plus
roo 9092 roo DM_ROO 9092bp 1049..1147 1333..1436 165 67.6 Plus
roo 9092 roo DM_ROO 9092bp 1076..1171 1470..1564 162 64.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2785..2984 1391..1582 161 56.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1518..1582 1356..1426 133 71.8 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7337..7458 1313..1434 123 60 Plus
Porto1 4682 Porto1 DOC5 4682bp 536..616 1377..1458 119 62.2 Plus

AT29920.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 00:56:46 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8127224..8127358 1905..2039 99   Plus
chr3R 8127060..8127107 1741..1788 100 == Plus
chr3R 8126747..8127003 1428..1684 100 == Plus
chr3R 8126549..8126629 1230..1310 100 == Plus
chr3R 8126283..8126476 964..1157 100 == Plus
chr3R 8125877..8126034 806..963 100 -> Plus
chr3R 8119395..8119946 254..805 100 -> Plus
chr3R 8115596..8115745 104..253 100 -> Plus
chr3R 8084139..8084241 1..103 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:37:27 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RB 653..1632 100..1080 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:48:34 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RB 653..1632 100..1080 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:51:50 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RE 653..1665 100..1113 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:15:56 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RB 653..1632 100..1080 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:46 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RE 653..1665 100..1113 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:37:27 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RC 1..2039 1..2039 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:48:33 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RC 1..2039 1..2039 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:51:50 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RC 13..2051 1..2039 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:15:56 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RC 1..2039 1..2039 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:46 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RC 13..2051 1..2039 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:46 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12300885..12301960 964..2039 99   Plus
3R 12300479..12300636 806..963 100 -> Plus
3R 12294008..12294559 254..805 100 -> Plus
3R 12290209..12290358 104..253 100 -> Plus
3R 12258749..12258851 1..103 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:51:50 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8126607..8127682 964..2039 99   Plus
arm_3R 8126201..8126358 806..963 100 -> Plus
arm_3R 8119730..8120281 254..805 100 -> Plus
arm_3R 8115931..8116080 104..253 100 -> Plus
arm_3R 8084471..8084573 1..103 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:49:50 Download gff for AT29920.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12041716..12042791 964..2039 99   Plus
3R 12041310..12041467 806..963 100 -> Plus
3R 12034839..12035390 254..805 100 -> Plus
3R 12031040..12031189 104..253 100 -> Plus
3R 11999580..11999682 1..103 100 -> Plus

AT29920.hyp Sequence

Translation from 234 to 1079

> AT29920.hyp
MGMRREAVQRGRVPPTQPGLAGMHGQYQIANGDPMGIAGFNGHSYLSSYI
SLLLRAEPYPTSRYGQCMQPNNIMGIDNICELAARLLFSAVEWAKNIPFF
PELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAAD
RVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTH
IESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFF
VRLVGKTPIETLIRDMLLSGNSFSWPYLPSM*

AT29920.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
svp-PC 281 CG11502-PC 1..281 1..281 1458 100 Plus
svp-PB 543 CG11502-PB 263..543 1..281 1458 100 Plus
svp-PE 554 CG11502-PE 263..543 1..281 1458 100 Plus
svp-PA 746 CG11502-PA 263..452 1..190 986 100 Plus
dsf-PB 691 CG9019-PB 449..681 41..266 381 37.2 Plus

AT29920.pep Sequence

Translation from 234 to 1079

> AT29920.pep
MGMRREAVQRGRVPPTQPGLAGMHGQYQIANGDPMGIAGFNGHSYLSSYI
SLLLRAEPYPTSRYGQCMQPNNIMGIDNICELAARLLFSAVEWAKNIPFF
PELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAAD
RVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTH
IESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFF
VRLVGKTPIETLIRDMLLSGNSFSWPYLPSM*

AT29920.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17240-PA 826 GF17240-PA 268..545 1..278 1491 97.8 Plus
Dana\GF15588-PA 702 GF15588-PA 509..691 81..266 362 42.9 Plus
Dana\GF13031-PA 552 GF13031-PA 352..549 77..266 330 42.4 Plus
Dana\GF14359-PA 735 GF14359-PA 236..500 2..270 321 33.2 Plus
Dana\GF21986-PA 512 GF21986-PA 261..499 53..267 300 30.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18706-PA 543 GG18706-PA 263..543 1..281 1510 100 Plus
Dere\GG25103-PA 693 GG25103-PA 501..683 81..266 363 42.9 Plus
Dere\GG20513-PA 630 GG20513-PA 403..627 57..266 334 40.9 Plus
Dere\GG24056-PA 704 GG24056-PA 206..470 2..270 324 33.2 Plus
Dere\GG12659-PA 507 GG12659-PA 259..485 53..258 286 31.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17319-PA 542 GH17319-PA 262..542 1..281 1485 97.5 Plus
Dgri\GH11011-PA 719 GH11011-PA 527..709 81..266 359 42.9 Plus
Dgri\GH13232-PA 774 GH13232-PA 303..567 2..270 325 33.3 Plus
Dgri\GH20427-PA 281 GH20427-PA 35..278 36..266 322 38.6 Plus
Dgri\GH24408-PA 528 GH24408-PA 294..515 68..267 305 31.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
svp-PC 281 CG11502-PC 1..281 1..281 1458 100 Plus
svp-PB 543 CG11502-PB 263..543 1..281 1458 100 Plus
svp-PE 554 CG11502-PE 263..543 1..281 1458 100 Plus
svp-PA 746 CG11502-PA 263..452 1..190 986 100 Plus
dsf-PB 691 CG9019-PB 449..681 41..266 381 37.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10282-PA 812 GI10282-PA 259..530 1..272 1481 98.5 Plus
Dmoj\GI17531-PA 736 GI17531-PA 544..726 81..266 360 42.9 Plus
Dmoj\GI12430-PA 715 GI12430-PA 238..502 2..270 324 33 Plus
Dmoj\GI19610-PA 589 GI19610-PA 394..586 77..266 318 42.4 Plus
Dmoj\GI15428-PA 484 GI15428-PA 242..473 53..269 314 32.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22274-PA 777 GL22274-PA 259..536 1..278 1484 97.8 Plus
Dper\GL19043-PA 819 GL19043-PA 625..807 81..266 354 42.3 Plus
Dper\GL17753-PA 259 GL17753-PA 21..256 46..266 332 39.8 Plus
Dper\GL26219-PA 518 GL26219-PA 208..472 2..270 319 32.9 Plus
Dper\GL13521-PA 454 GL13521-PA 228..448 73..266 261 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11038-PA 777 GA11038-PA 259..536 1..278 1482 97.8 Plus
Dpse\GA21482-PA 691 GA21482-PA 497..679 81..266 355 42.3 Plus
Dpse\GA30480-PA 626 GA30480-PA 392..623 50..266 332 40.1 Plus
Dpse\GA21689-PA 686 GA21689-PA 208..472 2..270 320 32.9 Plus
Dpse\GA18146-PA 487 GA18146-PA 244..476 53..269 311 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24010-PA 1085 GM24010-PA 273..459 4..190 992 98.4 Plus
Dsec\GM24010-PA 1085 GM24010-PA 748..835 191..278 433 93.2 Plus
Dsec\GM18580-PA 196 GM18580-PA 4..186 81..266 357 42.9 Plus
Dsec\GM12759-PA 703 GM12759-PA 205..469 2..270 324 33.2 Plus
Dsec\GM18927-PA 505 GM18927-PA 258..483 53..258 286 31.6 Plus
Dsec\GM23404-PA 808 GM23404-PA 617..777 76..238 217 29.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18809-PA 680 GD18809-PA 263..540 1..278 1469 97.8 Plus
Dsim\GD22387-PA 703 GD22387-PA 205..469 2..270 323 33.2 Plus
Dsim\GD11109-PA 414 GD11109-PA 192..411 57..266 317 40.4 Plus
Dsim\GD21550-PA 452 GD21550-PA 226..446 73..266 262 31.2 Plus
Dsim\GD16395-PA 217 GD16395-PA 2..195 91..258 247 32.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11090-PA 787 GJ11090-PA 258..529 1..272 1479 98.5 Plus
Dvir\GJ15408-PA 726 GJ15408-PA 534..716 81..266 360 42.9 Plus
Dvir\GJ14974-PA 577 GJ14974-PA 376..574 77..266 337 43.2 Plus
Dvir\GJ17882-PA 679 GJ17882-PA 206..470 2..270 325 33.3 Plus
Dvir\GJ16389-PA 499 GJ16389-PA 266..488 68..269 311 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11542-PA 835 GK11542-PA 261..538 1..278 1475 96.4 Plus
Dwil\GK14705-PA 730 GK14705-PA 538..720 81..266 363 42.9 Plus
Dwil\GK20892-PA 573 GK20892-PA 371..570 77..266 322 41.1 Plus
Dwil\GK18664-PA 691 GK18664-PA 193..457 2..270 322 33.2 Plus
Dwil\GK25746-PA 483 GK25746-PA 248..470 68..269 309 32 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26169-PA 543 GE26169-PA 263..543 1..281 1510 100 Plus
Dyak\GE25723-PA 691 GE25723-PA 499..681 81..266 363 42.9 Plus
Dyak\GE13645-PA 654 GE13645-PA 432..651 57..266 325 40.4 Plus
Dyak\GE10817-PA 703 GE10817-PA 205..469 2..270 315 32.9 Plus
Dyak\GE16988-PA 509 GE16988-PA 261..487 53..258 286 31.5 Plus