Clone BO01001 Report

Search the DGRC for BO01001

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptRpb10-RA
Protein status:BO01001.pep:
Sequenced Size:235

Clone Sequence Records

BO01001.3prime Sequence

233 bp (232 high quality bases) assembled on 2005-11-30

> BO01001.3prime
ATGGTCTAGAAAGCTTGCCTTCTCCAGAGGAGCATAGTTGAGCAGTTTTT
CGATAAGATCCACGTGGCCCAGGAGCATGCGACGGCAGCAGTACCTCTTT
AGACCCAAAGCATCCAGGGCATCTCCTTCGGTGTATTCCGCTTGCAGGAG
ACCCAAATACGACTCCCACTTGTTGCCAATGACCTTGCCGCAGGTGAAAC
AACGGATTGGAATAATCATGTCGACTGATAACT

BO01001.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13628-PA 204 Rpb10-RA 1..201 219..19 1005 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 18:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-RA 405 CG13628-RA 108..308 219..19 1005 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 18:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24717795..24717901 125..19 535 100 Minus
3R 32079331 3R 24717618..24717712 219..125 475 100 Minus
Blast to na_te.dros performed on 2015-02-09 18:11:20 has no hits.

BO01001.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:20:45 Download gff for BO01001.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-PA 1..204 16..219 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:13:18 Download gff for BO01001.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13628-PA 1..204 16..219 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 03:53:17 Download gff for BO01001.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..312 15..219 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:08:45 Download gff for BO01001.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..312 15..219 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:08:45 Download gff for BO01001.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 24717796..24717905 15..124 98   Minus
3R 24717618..24717712 125..219 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 03:53:17 Download gff for BO01001.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20543518..20543627 15..124 98   Minus
arm_3R 20543340..20543434 125..219 100 -> Minus

BO01001.5prime Sequence

233 bp (232 high quality bases) assembled on 2005-11-29

> BO01001.5prime
GAAGTTATCAGTCGACATGATTATTCCAATCCGTTGTTTCACCTGCGGCA
AGGTCATTGGCAACAAGTGGGAGTCGTATTTGGGTCTCCTGCAAGCGGAA
TACACCGAAGGAGATGCCCTGGATGCTTTGGGTCTAAAGAGGTACTGCTG
CCGTCGCATGCTCCTGGGCCACGTGGATCTTATCGAAAAACTGCTCAACT
ATGCTCCTCTGGAGAAGGCAAGCTTTCTAGACC

BO01001.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13628-PA 204 Rpb10-RA 1..201 17..217 1005 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-RA 405 CG13628-RA 108..308 17..217 1005 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24717795..24717901 111..217 535 100 Plus
3R 32079331 3R 24717618..24717712 17..111 475 100 Plus
Blast to na_te.dros performed on 2015-02-13 00:30:04 has no hits.

BO01001.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:20:46 Download gff for BO01001.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-PA 1..204 17..220 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:13:20 Download gff for BO01001.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13628-PA 1..204 17..220 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 21:57:04 Download gff for BO01001.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..312 17..221 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:52:02 Download gff for BO01001.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..312 17..221 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:52:02 Download gff for BO01001.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 24717796..24717905 112..221 98   Plus
3R 24717618..24717712 17..111 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 21:57:04 Download gff for BO01001.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20543518..20543627 112..221 98   Plus
arm_3R 20543340..20543434 17..111 100 -> Plus

BO01001.complete Sequence

235 bp (235 high quality bases) assembled on 2006-03-30

GenBank Submission: FJ629384

> BO01001.complete
GAAGTTATCAGTCGACATGATTATTCCAATCCGTTGTTTCACCTGCGGCA
AGGTCATTGGCAACAAGTGGGAGTCGTATTTGGGTCTCCTGCAAGCGGAA
TACACCGAAGGAGATGCCCTGGATGCTTTGGGTCTAAAGAGGTACTGCTG
CCGTCGCATGCTCCTGGGCCACGTGGATCTTATCGAAAAACTGCTCAACT
ATGCTCCTCTGGAGAAGGCAAGCTTTCTAGACCAT

BO01001.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-RA 204 CG13628-PA 1..201 17..217 1005 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-RA 405 CG13628-RA 108..308 17..217 1005 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24717795..24717901 111..217 535 100 Plus
3R 32079331 3R 24717618..24717712 17..111 475 100 Plus
Blast to na_te.dros performed on 2014-11-27 19:56:03 has no hits.

BO01001.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:35:43 Download gff for BO01001.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 1..204 17..220 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:56:53 Download gff for BO01001.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 65..269 17..221 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:01:05 Download gff for BO01001.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..308 17..219 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:35:43 Download gff for BO01001.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 65..269 17..221 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:11:07 Download gff for BO01001.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..308 17..219 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:11:07 Download gff for BO01001.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24717796..24717901 112..219 98   Plus
3R 24717618..24717712 17..111 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:01:05 Download gff for BO01001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20543518..20543623 112..219 98   Plus
arm_3R 20543340..20543434 17..111 100 -> Plus

BO01001.pep Sequence

Translation from 16 to 235

> BO01001.pep
MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLL
GHVDLIEKLLNYAPLEKASFLDH

BO01001.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-PA 67 CG13628-PA 1..67 1..67 360 100 Plus