Clone BO01006 Report

Search the DGRC for BO01006

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG6272-RA
Protein status:BO01006.pep: full length peptide match
Sequenced Size:373

Clone Sequence Records

BO01006.3prime Sequence

371 bp (370 high quality bases) assembled on 2005-11-30

> BO01006.3prime
ATGGTCTAGAAAGCTTGCGTCATTGTCCTTGGGATCGGGATCTGGTTCAG
CGAGAATCTCCTGGATGATTCGATGGCCGTCCTCCGTTTTCTCACCCTGA
ATGATCAGATCTCTAAGCGTAGATATATGTTTTTCACTCGTCTCGATCTG
AACCTTAAGAGCATCGTTTTGCTTCCTCAAATCATCGATGCGTTTCTTAC
GTTCCTCGGCCGATTTCTTGGTCTTTTCGCGTGTGCGCTGAACAGCCTCA
TTGTTTTTCTTTCTTTTTTCTTTGTACGCTGGATCGTCTGTGTGCGGACT
TAATGGCGAATCGCTATTTTTGCTGGTCGACGCGGCAGTTCTCTTTTTGG
CCGGCATGTCGACTGATAACT

BO01006.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG6272-PA 342 CG6272-RA 1..339 357..19 1695 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG6272-RB 614 CG6272-RB 77..415 357..19 1695 100 Minus
CG6272-RA 543 CG6272-RA 77..415 357..19 1695 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11097645..11097874 19..248 1150 100 Plus
3L 28110227 3L 11097999..11098110 246..357 560 100 Plus
Blast to na_te.dros performed on 2015-02-12 05:40:52 has no hits.

BO01006.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:20:54 Download gff for BO01006.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6272-PA 1..342 15..357 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:13:30 Download gff for BO01006.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6272-PA 1..342 15..357 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:16:45 Download gff for BO01006.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 77..418 15..357 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:37:55 Download gff for BO01006.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 77..418 15..357 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:37:55 Download gff for BO01006.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 11098000..11098110 247..357 100   Plus
3L 11097642..11097872 15..246 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:16:45 Download gff for BO01006.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11091100..11091210 247..357 100   Plus
arm_3L 11090742..11090972 15..246 99 <- Plus

BO01006.5prime Sequence

371 bp (370 high quality bases) assembled on 2005-11-30

> BO01006.5prime
GAAGTTATCAGTCGACATGCCGGCCAAAAAGAGAACTGCCGCGTCGACCA
GCAAAAATAGCGATTCGCCATTAAGTCCGCACACAGACGATCCAGCGTAC
AAAGAAAAAAGAAAGAAAAACAATGAGGCTGTTCAGCGCACACGCGAAAA
GACCAAGAAATCGGCCGAGGAACGTAAGAAACGCATCGATGATTTGAGGA
AGCAAAACGATGCTCTTAAGGTTCAGATCGAGACGAGTGAAAAACATATA
TCTACGCTTAGAGATCTGATCATTCAGGGTGAGAAAACGGAGGACGGCCA
TCGAATCATCCAGGAGATTCTCGCTGAACCAGATCCCGATCCCAAGGACA
ATGACGCAAGCTTTCTAGACC

BO01006.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG6272-PA 342 CG6272-RA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6272-RB 614 CG6272-RB 77..415 17..355 1695 100 Plus
CG6272-RA 543 CG6272-RA 77..415 17..355 1695 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 18:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11097645..11097874 355..126 1150 100 Minus
3L 28110227 3L 11097999..11098110 128..17 560 100 Minus
Blast to na_te.dros performed on 2015-02-11 18:11:08 has no hits.

BO01006.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:20:55 Download gff for BO01006.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6272-PA 1..342 17..359 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:13:32 Download gff for BO01006.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6272-PA 1..342 17..359 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:46:46 Download gff for BO01006.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 77..418 17..359 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:38:23 Download gff for BO01006.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 77..418 17..359 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:38:23 Download gff for BO01006.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 11098000..11098110 17..127 100   Minus
3L 11097642..11097872 128..359 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:46:46 Download gff for BO01006.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11091100..11091210 17..127 100   Minus
arm_3L 11090742..11090972 128..359 99 <- Minus

BO01006.complete Sequence

373 bp (373 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629385

> BO01006.complete
GAAGTTATCAGTCGACATGCCGGCCAAAAAGAGAACTGCCGCGTCGACCA
GCAAAAATAGCGATTCGCCATTAAGTCCGCACACAGACGATCCAGCGTAC
AAAGAAAAAAGAAAGAAAAACAATGAGGCTGTTCAGCGCACACGCGAAAA
GACCAAGAAATCGGCCGAGGAACGTAAGAAACGCATCGATGATTTGAGGA
AGCAAAACGATGCTCTTAAGGTTCAGATCGAGACGAGTGAAAAACATATA
TCTACGCTTAGAGATCTGATCATTCAGGGTGAGAAAACGGAGGACGGCCA
TCGAATCATCCAGGAGATTCTCGCTGAACCAGATCCCGATCCCAAGGACA
ATGACGCAAGCTTTCTAGACCAT

BO01006.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG6272-RB 342 CG6272-PB 1..339 17..355 1695 100 Plus
CG6272-RA 342 CG6272-PA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG6272-RB 614 CG6272-RB 77..415 17..355 1695 100 Plus
CG6272-RA 543 CG6272-RA 77..415 17..355 1695 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11097645..11097874 355..126 1150 100 Minus
3L 28110227 3L 11097999..11098110 128..17 560 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:06:12 has no hits.

BO01006.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:48 Download gff for BO01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..342 17..359 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:54 Download gff for BO01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 77..418 17..359 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:09 Download gff for BO01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 77..415 17..357 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:48 Download gff for BO01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 77..418 17..359 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:00:03 Download gff for BO01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 77..415 17..357 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:00:03 Download gff for BO01006.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11098000..11098110 17..127 100   Minus
3L 11097643..11097872 128..357 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:09 Download gff for BO01006.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11091100..11091210 17..127 100   Minus
arm_3L 11090743..11090972 128..357 99 <- Minus

BO01006.pep Sequence

Translation from 16 to 373

> BO01006.pep
MPAKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSA
EERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGEKTEDGHRIIQE
ILAEPDPDPKDNDASFLDH

BO01006.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG6272-PB 113 CG6272-PB 1..113 1..113 577 100 Plus
CG6272-PA 113 CG6272-PA 1..113 1..113 577 100 Plus