Clone BO01008 Report

Search the DGRC for BO01008

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG2611-RA
Protein status:BO01008.pep: full length peptide match
Sequenced Size:430

Clone Sequence Records

BO01008.3prime Sequence

428 bp (427 high quality bases) assembled on 2005-11-30

> BO01008.3prime
ATGGTCTAGAAAGCTTGCGCCGAGTCTTCGTATCTCGTCCATGGTGAATC
CGTTGCGGTTGAGCATTATGCAGAAGAGCACGTACACATAGTAGCTTCCC
GGGATGAAGGTCAGTGCCCCGATGATACCCAACGCCCACACCCGATCCGA
TCGCTCCCGGCTCGTGTCCGTCACCCAGTTTAAGGTGGCAAAGGCGATGC
AAACAATGCCACCGATAAACAGCAAAAGAATGATAATAATGGTCTTCCAA
GGCACTGGACCTGGCATCGCCGGTTCCGTCCACTGTTCATTAACGAATCC
ATCGGTCTCGCATTGGGACTCCACCACCTTGATGTACTCTCCGGAGCCTG
CTGGCGCGGAACTCCTGCCCCCTCCATTTAGGCGGTGCCGCGACTCCGAA
TTGGTGGGCTCCATGTCGACTGATAACT

BO01008.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG2611-PA 399 CG2611-RA 1..396 414..19 1980 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG2611-RA 634 CG2611-RA 63..458 414..19 1980 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20650251..20650462 414..203 1060 100 Minus
2L 23513712 2L 20650537..20650722 204..19 930 100 Minus
Blast to na_te.dros performed on 2015-02-12 10:08:07 has no hits.

BO01008.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:20:58 Download gff for BO01008.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2611-PA 1..399 16..414 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:13:37 Download gff for BO01008.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2611-PA 1..399 16..414 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:46:52 Download gff for BO01008.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 58..462 15..422 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:06:42 Download gff for BO01008.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 58..462 15..422 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:06:42 Download gff for BO01008.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 20650537..20650729 14..204 98 -> Minus
2L 20650246..20650460 205..422 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:46:52 Download gff for BO01008.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20650537..20650729 14..204 98 -> Minus
arm_2L 20650246..20650460 205..422 98 -> Minus

BO01008.5prime Sequence

428 bp (427 high quality bases) assembled on 2005-11-30

> BO01008.5prime
GAAGTTATCAGTCGACATGGAGCCCACCAATTCGGAGTCGCGGCACCGCC
TAAATGGAGGGGGCAGGAGTTCCGCGCCAGCAGGCTCCGGAGAGTACATC
AAGGTGGTGGAGTCCCAATGCGAGACCGATGGATTCGTTAATGAACAGTG
GACGGAACCGGCGATGCCAGGTCCAGTGCCTTGGAAGACCATTATTATCA
TTCTTTTGCTGTTTATCGGTGGCATTGTTTGCATCGCCTTTGCCACCTTA
AACTGGGTGACGGACACGAGCCGGGAGCGATCGGATCGGGTGTGGGCGTT
GGGTATCATCGGGGCACTGACCTTCATCCCGGGAAGCTACTATGTGTACG
TGCTCTTCTGCATAATGCTCAACCGCAACGGATTCACCATGGACGAGATA
CGAAGACTCGGCGCAAGCTTTCTAGACC

BO01008.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG2611-PA 399 CG2611-RA 1..396 17..412 1980 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG2611-RA 634 CG2611-RA 63..458 17..412 1980 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20650251..20650462 17..228 1060 100 Plus
2L 23513712 2L 20650537..20650722 227..412 930 100 Plus
Blast to na_te.dros performed on 2015-02-11 04:08:25 has no hits.

BO01008.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:20:59 Download gff for BO01008.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2611-PA 1..399 17..415 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:13:39 Download gff for BO01008.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2611-PA 1..399 17..415 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:42:32 Download gff for BO01008.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 58..462 9..416 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:14:06 Download gff for BO01008.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 58..462 9..416 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:14:06 Download gff for BO01008.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 20650537..20650729 227..417 98 -> Plus
2L 20650246..20650460 9..226 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:42:32 Download gff for BO01008.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20650537..20650729 227..417 98 -> Plus
arm_2L 20650246..20650460 9..226 98 -> Plus

BO01008.complete Sequence

430 bp (430 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629386

> BO01008.complete
GAAGTTATCAGTCGACATGGAGCCCACCAATTCGGAGTCGCGGCACCGCC
TAAATGGAGGGGGCAGGAGTTCCGCGCCAGCAGGCTCCGGAGAGTACATC
AAGGTGGTGGAGTCCCAATGCGAGACCGATGGATTCGTTAATGAACAGTG
GACGGAACCGGCGATGCCAGGTCCAGTGCCTTGGAAGACCATTATTATCA
TTCTTTTGCTGTTTATCGGTGGCATTGTTTGCATCGCCTTTGCCACCTTA
AACTGGGTGACGGACACGAGCCGGGAGCGATCGGATCGGGTGTGGGCGTT
GGGTATCATCGGGGCACTGACCTTCATCCCGGGAAGCTACTATGTGTACG
TGCTCTTCTGCATAATGCTCAACCGCAACGGATTCACCATGGACGAGATA
CGAAGACTCGGCGCAAGCTTTCTAGACCAT

BO01008.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG2611-RA 399 CG2611-PA 1..396 17..412 1980 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG2611-RA 634 CG2611-RA 63..458 17..412 1980 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20650251..20650462 17..228 1060 100 Plus
2L 23513712 2L 20650537..20650722 227..412 930 100 Plus
Blast to na_te.dros performed on 2014-11-27 20:13:52 has no hits.

BO01008.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:49 Download gff for BO01008.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 1..399 17..415 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:56 Download gff for BO01008.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 53..457 9..416 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:05:12 Download gff for BO01008.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 63..458 17..414 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:49 Download gff for BO01008.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 53..457 9..416 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:17:38 Download gff for BO01008.complete
Subject Subject Range Query Range Percent Splice Strand
CG2611-RA 63..458 17..414 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:17:38 Download gff for BO01008.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20650537..20650722 227..414 98   Plus
2L 20650251..20650460 17..226 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:05:12 Download gff for BO01008.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20650537..20650722 227..414 98   Plus
arm_2L 20650251..20650460 17..226 100 -> Plus

BO01008.pep Sequence

Translation from 16 to 430

> BO01008.pep
MEPTNSESRHRLNGGGRSSAPAGSGEYIKVVESQCETDGFVNEQWTEPAM
PGPVPWKTIIIILLLFIGGIVCIAFATLNWVTDTSRERSDRVWALGIIGA
LTFIPGSYYVYVLFCIMLNRNGFTMDEIRRLGASFLDH

BO01008.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG2611-PA 132 CG2611-PA 1..132 1..132 703 100 Plus