Clone BO01012 Report

Search the DGRC for BO01012

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:12
Vector:pDNR-Dual
Associated Gene/Transcriptgrh-RM
Protein status:BO01012.pep:
Sequenced Size:499

Clone Sequence Records

BO01012.3prime Sequence

497 bp (496 high quality bases) assembled on 2005-11-30

> BO01012.3prime
ATGGTCTAGAAAGCTTGCATTTTCGCAGTAATCCGCATTTAGCAGGCCGA
TCGTGGTGGGCGGCACCACGTGCAACGGTGTATACACCTCCTCGTTCTCC
TGCCGCACGTACAGCATCACGCGTTCCGAGGTCGGCGGCGTCATCCTGCC
GCGCTTCATCGGCGGACCAAAGTCGGTCAGGGGTGTGCTGGTCAACATGT
TCTGGTCCAGTATGTGATCCTTCTTATCGGTCTGCATGTCGGGCGGAAAA
TGGTTGTGGAACTTGAGCGTCGGCGTGGCCACCTTCTGGCCGTGGAGCAG
GAACGGTGAGGCCCCCTTCAGGTCCGGCGAGTCAGTCTCATGGCCGTAGA
AGCTCTTCTCCATGTCCTCGGCGGGCGAGAATAGCACCGGCGGCTTGGCG
AAGTCCTGCATGCCATAGAACTCGGACCGATCCGTTACCGGATGGTAAAG
CTCGTCCAGCTTCTTTCTGCCCGTGGCTGTCATGTCGACTGATAACT

BO01012.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5058-PF 468 grh-RF 1..465 483..19 2325 100 Minus
CG5058-PC 3909 grh-RC 3268..3717 483..34 2250 100 Minus
CG5058-PB 3099 grh-RB 2458..2907 483..34 2250 100 Minus
CG5058-PG 2190 grh-RG 1676..1998 356..34 1615 100 Minus
CG5058-PA 3192 grh-RA 2678..3000 356..34 1615 100 Minus
CG5058-PD 4002 grh-RD 3488..3810 356..34 1615 100 Minus
CG5058-PG 2190 grh-RG 1456..1584 483..355 645 100 Minus
CG5058-PA 3192 grh-RA 2458..2586 483..355 645 100 Minus
CG5058-PD 4002 grh-RD 3268..3396 483..355 645 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
grh-RO 3094 CG42311-RO 1799..2248 483..34 2250 100 Minus
grh-RL 6692 CG42311-RL 4105..4554 483..34 2250 100 Minus
grh-RH 3972 CG42311-RH 3295..3744 483..34 2250 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17839594..17839790 229..33 985 100 Minus
2R 25286936 2R 17839093..17839221 483..355 645 100 Minus
2R 25286936 2R 17839313..17839439 356..230 635 100 Minus
Blast to na_te.dros performed on 2015-02-12 00:40:54 has no hits.

BO01012.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:02 Download gff for BO01012.3prime
Subject Subject Range Query Range Percent Splice Strand
grh-PF 1..468 16..483 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:13:46 Download gff for BO01012.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5058-PF 1..468 16..483 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:31:33 Download gff for BO01012.3prime
Subject Subject Range Query Range Percent Splice Strand
grh-RH 3808..3824 19..36 94   Minus
grh-RH 3295..3741 37..483 100 -> Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:08:10 Download gff for BO01012.3prime
Subject Subject Range Query Range Percent Splice Strand
grh-RH 3808..3824 19..36 94   Minus
grh-RH 3295..3741 37..483 100 -> Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:08:10 Download gff for BO01012.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 17839594..17839789 34..229 100 -> Minus
2R 17839315..17839439 230..354 100 -> Minus
2R 17839093..17839221 355..483 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:31:33 Download gff for BO01012.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13727099..13727294 34..229 100 -> Minus
arm_2R 13726820..13726944 230..354 100 -> Minus
arm_2R 13726598..13726726 355..483 100 -> Minus

BO01012.5prime Sequence

497 bp (496 high quality bases) assembled on 2005-11-30

> BO01012.5prime
GAAGTTATCAGTCGACATGACAGCCACGGGCAGAAAGAAGCTGGACGAGC
TTTACCATCCGGTAACGGATCGGTCCGAGTTCTATGGCATGCAGGACTTC
GCCAAGCCGCCGGTGCTATTCTCGCCCGCCGAGGACATGGAGAAGAGCTT
CTACGGCCATGAGACTGACTCGCCGGACCTGAAGGGGGCCTCACCGTTCC
TGCTCCACGGCCAGAAGGTGGCCACGCCGACGCTCAAGTTCCACAACCAT
TTTCCGCCCGACATGCAGACCGATAAGAAGGATCACATACTGGACCAGAA
CATGTTGACCAGCACACCCCTGACCGACTTTGGTCCGCCGATGAAGCGCG
GCAGGATGACGCCGCCGACCTCGGAACGCGTGATGCTGTACGTGCGGCAG
GAGAACGAGGAGGTGTATACACCGTTGCACGTGGTGCCGCCCACCACGAT
CGGCCTGCTAAATGCGGATTACTGCGAAAATGCAAGCTTTCTAGACC

BO01012.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG5058-PF 468 grh-RF 1..465 17..481 2325 100 Plus
CG5058-PC 3909 grh-RC 3268..3717 17..466 2250 100 Plus
CG5058-PB 3099 grh-RB 2458..2907 17..466 2250 100 Plus
CG5058-PG 2190 grh-RG 1676..1998 144..466 1615 100 Plus
CG5058-PA 3192 grh-RA 2678..3000 144..466 1615 100 Plus
CG5058-PD 4002 grh-RD 3488..3810 144..466 1615 100 Plus
CG5058-PG 2190 grh-RG 1456..1584 17..145 645 100 Plus
CG5058-PA 3192 grh-RA 2458..2586 17..145 645 100 Plus
CG5058-PD 4002 grh-RD 3268..3396 17..145 645 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
grh-RO 3094 CG42311-RO 1799..2248 17..466 2250 100 Plus
grh-RL 6692 CG42311-RL 4105..4554 17..466 2250 100 Plus
grh-RH 3972 CG42311-RH 3295..3744 17..466 2250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17839594..17839790 271..467 985 100 Plus
2R 25286936 2R 17839093..17839221 17..145 645 100 Plus
2R 25286936 2R 17839313..17839439 144..270 635 100 Plus
Blast to na_te.dros performed on 2015-02-04 18:42:11 has no hits.

BO01012.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:03 Download gff for BO01012.5prime
Subject Subject Range Query Range Percent Splice Strand
grh-PF 1..468 17..484 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:13:48 Download gff for BO01012.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5058-PF 1..468 17..484 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:10:51 Download gff for BO01012.5prime
Subject Subject Range Query Range Percent Splice Strand
grh-RH 3808..3824 464..481 94   Plus
grh-RH 3295..3741 17..463 100 -> Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:25:55 Download gff for BO01012.5prime
Subject Subject Range Query Range Percent Splice Strand
grh-RH 3808..3824 464..481 94   Plus
grh-RH 3295..3741 17..463 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:25:55 Download gff for BO01012.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 17839594..17839789 271..466 100 -> Plus
2R 17839315..17839439 146..270 100 -> Plus
2R 17839093..17839221 17..145 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:10:51 Download gff for BO01012.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13727099..13727294 271..466 100 -> Plus
arm_2R 13726820..13726944 146..270 100 -> Plus
arm_2R 13726598..13726726 17..145 100 -> Plus

BO01012.complete Sequence

499 bp (499 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629388

> BO01012.complete
GAAGTTATCAGTCGACATGACAGCCACGGGCAGAAAGAAGCTGGACGAGC
TTTACCATCCGGTAACGGATCGGTCCGAGTTCTATGGCATGCAGGACTTC
GCCAAGCCGCCGGTGCTATTCTCGCCCGCCGAGGACATGGAGAAGAGCTT
CTACGGCCATGAGACTGACTCGCCGGACCTGAAGGGGGCCTCACCGTTCC
TGCTCCACGGCCAGAAGGTGGCCACGCCGACGCTCAAGTTCCACAACCAT
TTTCCGCCCGACATGCAGACCGATAAGAAGGATCACATACTGGACCAGAA
CATGTTGACCAGCACACCCCTGACCGACTTTGGTCCGCCGATGAAGCGCG
GCAGGATGACGCCGCCGACCTCGGAACGCGTGATGCTGTACGTGCGGCAG
GAGAACGAGGAGGTGTATACACCGTTGCACGTGGTGCCGCCCACCACGAT
CGGCCTGCTAAATGCGGATTACTGCGAAAATGCAAGCTTTCTAGACCAT

BO01012.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
grh-RO 2097 CG42311-PO 1456..1905 17..466 2250 100 Plus
grh-RL 3909 CG42311-PL 3268..3717 17..466 2250 100 Plus
grh-RH 3099 CG42311-PH 2458..2907 17..466 2250 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
grh-RO 3094 CG42311-RO 1799..2248 17..466 2250 100 Plus
grh-RL 6692 CG42311-RL 4105..4554 17..466 2250 100 Plus
grh-RH 3972 CG42311-RH 3295..3744 17..466 2250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17839594..17839790 271..467 985 100 Plus
2R 25286936 2R 17839093..17839221 17..145 645 100 Plus
2R 25286936 2R 17839313..17839439 144..270 635 100 Plus
Blast to na_te.dros performed on 2014-11-27 20:52:43 has no hits.

BO01012.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:51 Download gff for BO01012.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RE 1..468 17..484 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:58 Download gff for BO01012.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RE 447..911 17..481 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:12:29 Download gff for BO01012.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RH 3295..3741 17..463 100 -> Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:51 Download gff for BO01012.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RE 447..911 17..481 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:30:10 Download gff for BO01012.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RH 3295..3741 17..463 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:30:10 Download gff for BO01012.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17839594..17839789 271..466 100 -> Plus
2R 17839315..17839439 146..270 100 -> Plus
2R 17839093..17839221 17..145 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:12:29 Download gff for BO01012.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13727099..13727294 271..466 100 -> Plus
arm_2R 13726820..13726944 146..270 100 -> Plus
arm_2R 13726598..13726726 17..145 100 -> Plus

BO01012.pep Sequence

Translation from 16 to 499

> BO01012.pep
MTATGRKKLDELYHPVTDRSEFYGMQDFAKPPVLFSPAEDMEKSFYGHET
DSPDLKGASPFLLHGQKVATPTLKFHNHFPPDMQTDKKDHILDQNMLTST
PLTDFGPPMKRGRMTPPTSERVMLYVRQENEEVYTPLHVVPPTTIGLLNA
DYCENASFLDH

BO01012.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
grh-PO 698 CG42311-PO 486..635 1..150 809 100 Plus
grh-PH 1032 CG42311-PH 820..969 1..150 809 100 Plus
grh-PL 1302 CG42311-PL 1090..1239 1..150 809 100 Plus
grh-PN 729 CG42311-PN 486..666 1..150 767 82.9 Plus
grh-PK 784 CG42311-PK 541..721 1..150 767 82.9 Plus