Clone BO01018 Report

Search the DGRC for BO01018

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:18
Vector:pDNR-Dual
Associated Gene/Transcriptbun-RC
Protein status:BO01018.pep: full length peptide match
Sequenced Size:601

Clone Sequence Records

BO01018.3prime Sequence

599 bp (598 high quality bases) assembled on 2005-11-30

> BO01018.3prime
ATGGTCTAGAAAGCTTGCGGACATGGGACCATTGGCTGTGACTACCGATG
CTGCTGCTGCCGCTGCTGATGTCACCTGCTGCACCTGCTGCTCCACCGAT
ACCGCTGCTGACTCGACTGCACTGCTGCCGTTCTCGGCGCTGCCGTTGGG
AATGCTCGTGGGTACCACCGCGGACGCTGGACTGGTGGCCACACCCGTTA
CCGCTACCGCTCCAGCGGCCTGCTGCTGAACTGCCTGACCCGCGGCAGCT
GGAGCAACGACACTTTGTACCGCCGGTGCCGCTTGAATGGCGGGCGTGGC
CGGCGGTGCGGCGAGTTGTAGCTGCAACTGCAGCTGCTGCAGTGTCTCCT
GCGGGATGTTCGACTTGAGAATGCTGTTCTCGAGCTCCAGCTTGTTGATC
TTGTCCATCAGCTCGGAGATGCGCTCTTTTAGCACTTCCACCTCCTCGCG
CACCGCTATCATGAGATGCGACTTGACCAGATCTTTTGCATTAGGCACCA
TCACATAGCAGGGGCTGTCGTAGCCCTTCTGCCAAATCTCGTATAGCCAA
TTCTCTGGCTGGCGCAGCGACATAGTGCCCATCATGTCGACTGATAACT

BO01018.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG5461-PC 570 bun-RC 1..567 585..19 2835 100 Minus
CG5461-PD 681 bun-RD 214..678 483..19 2325 100 Minus
CG5461-PE 765 bun-RE 298..762 483..19 2325 100 Minus
CG5461-PF 3294 bun-RF 2827..3291 483..19 2325 100 Minus
CG5461-PA 3621 bun-RA 3154..3618 483..19 2325 100 Minus
CG5461-PB 660 bun-RB 193..657 483..19 2325 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
bun-RP 5139 CG42281-RP 3391..3957 585..19 2835 100 Minus
bun-RC 1754 CG5461-RC 567..1133 585..19 2835 100 Minus
bun-RO 3490 CG42281-RO 807..1271 483..19 2325 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12457759..12458223 19..483 2325 100 Plus
2L 23513712 2L 12460588..12460690 483..585 515 100 Plus
Blast to na_te.dros performed on 2015-02-12 10:08:14 has no hits.

BO01018.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:09 Download gff for BO01018.3prime
Subject Subject Range Query Range Percent Splice Strand
bun-PC 1..570 15..585 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:00 Download gff for BO01018.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5461-PC 1..570 15..585 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:46:55 Download gff for BO01018.3prime
Subject Subject Range Query Range Percent Splice Strand
bun-RC 559..1136 15..592 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:06:55 Download gff for BO01018.3prime
Subject Subject Range Query Range Percent Splice Strand
bun-RC 559..1136 15..592 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:06:55 Download gff for BO01018.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 12460589..12460698 484..592 96   Plus
2L 12457755..12458223 15..483 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:46:55 Download gff for BO01018.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12460589..12460698 484..592 96   Plus
arm_2L 12457755..12458223 15..483 99 <- Plus

BO01018.5prime Sequence

599 bp (598 high quality bases) assembled on 2005-11-30

> BO01018.5prime
GAAGTTATCAGTCGACATGATGGGCACTATGTCGCTGCGCCAGCCAGAGA
ATTGGCTATACGAGATTTGGCAGAAGGGCTACGACAGCCCCTGCTATGTG
ATGGTGCCTAATGCAAAAGATCTGGTCAAGTCGCATCTCATGATAGCGGT
GCGCGAGGAGGTGGAAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGACA
AGATCAACAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCG
CAGGAGACACTGCAGCAGCTGCAGTTGCAGCTACAACTCGCCGCACCGCC
GGCCACGCCCGCCATTCAAGCGGCACCGGCGGTACAAAGTGTCGTTGCTC
CAGCTGCCGCGGGTCAGGCAGTTCAGCAGCAGGCCGCTGGAGCGGTAGCG
GTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCCACGAGCAT
TCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTCAGCAGCGG
TATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCAGCAGCGGCAGCAGCA
GCATCGGTAGTCACAGCCAATGGTCCCATGTCCGCAAGCTTTCTAGACC

BO01018.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG5461-PC 570 bun-RC 1..567 17..583 2835 100 Plus
CG5461-PD 681 bun-RD 214..678 119..583 2325 100 Plus
CG5461-PE 765 bun-RE 298..762 119..583 2325 100 Plus
CG5461-PF 3294 bun-RF 2827..3291 119..583 2325 100 Plus
CG5461-PA 3621 bun-RA 3154..3618 119..583 2325 100 Plus
CG5461-PB 660 bun-RB 193..657 119..583 2325 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
bun-RP 5139 CG42281-RP 3391..3957 17..583 2835 100 Plus
bun-RC 1754 CG5461-RC 567..1133 17..583 2835 100 Plus
bun-RO 3490 CG42281-RO 807..1271 119..583 2325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12457759..12458223 583..119 2325 100 Minus
2L 23513712 2L 12460588..12460690 119..17 515 100 Minus
Blast to na_te.dros performed on 2015-02-04 18:42:25 has no hits.

BO01018.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:10 Download gff for BO01018.5prime
Subject Subject Range Query Range Percent Splice Strand
bun-PC 1..570 17..587 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:02 Download gff for BO01018.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5461-PC 1..570 17..587 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:10:52 Download gff for BO01018.5prime
Subject Subject Range Query Range Percent Splice Strand
bun-RC 559..1136 10..587 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:25:57 Download gff for BO01018.5prime
Subject Subject Range Query Range Percent Splice Strand
bun-RC 559..1136 10..587 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:25:57 Download gff for BO01018.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 12460589..12460698 10..118 96   Minus
2L 12457755..12458223 119..587 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:10:52 Download gff for BO01018.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12460589..12460698 10..118 96   Minus
arm_2L 12457755..12458223 119..587 99 <- Minus

BO01018.complete Sequence

601 bp (601 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629390

> BO01018.complete
GAAGTTATCAGTCGACATGATGGGCACTATGTCGCTGCGCCAGCCAGAGA
ATTGGCTATACGAGATTTGGCAGAAGGGCTACGACAGCCCCTGCTATGTG
ATGGTGCCTAATGCAAAAGATCTGGTCAAGTCGCATCTCATGATAGCGGT
GCGCGAGGAGGTGGAAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGACA
AGATCAACAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCG
CAGGAGACACTGCAGCAGCTGCAGTTGCAGCTACAACTCGCCGCACCGCC
GGCCACGCCCGCCATTCAAGCGGCACCGGCGGTACAAAGTGTCGTTGCTC
CAGCTGCCGCGGGTCAGGCAGTTCAGCAGCAGGCCGCTGGAGCGGTAGCG
GTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCCACGAGCAT
TCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTCAGCAGCGG
TATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCAGCAGCGGCAGCAGCA
GCATCGGTAGTCACAGCCAATGGTCCCATGTCCGCAAGCTTTCTAGACCA
T

BO01018.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
bun-RP 3414 CG42281-PP 2845..3411 17..583 2835 100 Plus
bun-RC 570 CG42281-PC 1..567 17..583 2835 100 Plus
bun-RO 579 CG42281-PO 112..576 119..583 2325 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
bun-RP 5139 CG42281-RP 3391..3957 17..583 2835 100 Plus
bun-RC 1754 CG5461-RC 567..1133 17..583 2835 100 Plus
bun-RO 3490 CG42281-RO 807..1271 119..583 2325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12457759..12458223 583..119 2325 100 Minus
2L 23513712 2L 12460588..12460690 119..17 515 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:40:31 has no hits.

BO01018.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:53 Download gff for BO01018.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RI 1..570 17..587 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:19:01 Download gff for BO01018.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RI 540..1117 10..587 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:31:38 Download gff for BO01018.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RC 567..1133 17..585 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:54 Download gff for BO01018.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RI 540..1117 10..587 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:56 Download gff for BO01018.complete
Subject Subject Range Query Range Percent Splice Strand
bun-RC 567..1133 17..585 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:27:56 Download gff for BO01018.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12460589..12460690 17..118 100   Minus
2L 12457757..12458223 119..585 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:31:38 Download gff for BO01018.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12460589..12460690 17..118 100   Minus
arm_2L 12457757..12458223 119..585 99 <- Minus

BO01018.pep Sequence

Translation from 16 to 601

> BO01018.pep
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAPAVQSVVAPAAAGQAVQQQAAGAVAVTGVATSPASAVVPTSIPNGSA
ENGSSAVESAAVSVEQQVQQVTSAAAAAASVVTANGPMSASFLDH

BO01018.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
bun-PC 189 CG5461-PC 1..189 1..189 921 100 Plus
bun-PP 1137 CG42281-PP 949..1137 1..189 921 100 Plus
bun-PO 192 CG42281-PO 33..192 30..189 731 97.5 Plus
bun-PB 219 CG5461-PB 60..219 30..189 731 97.5 Plus
bun-PH 226 CG42281-PN 67..226 30..189 731 97.5 Plus