Clone BO01020 Report

Search the DGRC for BO01020

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:20
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO01020.pep:
Sequenced Size:613

Clone Sequence Records

BO01020.3prime Sequence

611 bp (610 high quality bases) assembled on 2005-11-30

> BO01020.3prime
ATGGTCTAGAAAGCTTGCACTTATCAGGGACATCCCACCTGAATCCGTCT
CCGAACTCGATGGACGGGGGCTGATGTTGGTGTGGGACATCTGTGGACTG
GCCTGCAGCAGGTTGTCGCCGTAAGATCCCGGCACCGGAACAGAAACGGG
CAGCGTGTAGCTGCTGTTTGGAAGCTGGCGAGGGGCACCCGCACCGCCGA
TGGCCATCTGGTTGCGCTGCATCATGTTCTGGAACTCCTCGTCGATCTTG
TTGTACTTGGCCTCCGTTCGCGGAGTGAGTGTGTAGTCCGTTTCGGCTTC
GGGCGAGTCCGGCGACATCACGCCGTTCTTGTTCTCCTTCTCGATGATGT
TCTTGTTGGTGAGGGACTCGTGGGGCTCGTTGTACTCGGTGTACTTGAGC
AGGACGCGATCCATGTCGGTGCTGGCGTACTGGTACAGCTTGTTGCTCGA
CGAGAAGATGATCAGGGCGATCTCGCAGTCGCAGAGCACGGACAGCTCGT
AGGCCTTCTTCATCACGCCGAACTTGCGCTTGTTGAAGGTCACCTGCCGA
TTGCGTTCATCGGTGATGCGTGATATTTGAATTTTTTTGCGGCCCATGTC
GACTGATAACT

BO01020.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG1429-PE 582 Mef2-RE 1..579 597..19 2895 100 Minus
CG1429-PD 1623 Mef2-RD 1..577 597..21 2885 100 Minus
CG1429-PC 1548 Mef2-RC 1..577 597..21 2885 100 Minus
CG1429-PB 1530 Mef2-RB 1..559 597..39 2795 100 Minus
CG1429-PF 1506 Mef2-RF 1..559 597..39 2795 100 Minus
CG1429-PA 1551 Mef2-RA 1..559 597..39 2795 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 15:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2-RG 5240 CG1429-RG 2460..3037 598..21 2890 100 Minus
Mef2-RC 5854 CG1429-RC 1056..1633 598..21 2890 100 Minus
Mef2-RD 3690 CG1429-RD 1439..2016 598..21 2890 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 15:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9919427..9919749 19..341 1615 100 Plus
2R 25286936 2R 9920519..9920725 340..546 1035 100 Plus
2R 25286936 2R 9921606..9921664 540..598 295 100 Plus
Blast to na_te.dros performed on 2015-02-12 15:58:08 has no hits.

BO01020.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:13 Download gff for BO01020.3prime
Subject Subject Range Query Range Percent Splice Strand
Mef2-PE 1..582 18..597 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:08 Download gff for BO01020.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1429-PE 1..582 18..597 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:23:35 Download gff for BO01020.3prime
Subject Subject Range Query Range Percent Splice Strand
Mef2-RD 1430..2016 21..607 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:31:15 Download gff for BO01020.3prime
Subject Subject Range Query Range Percent Splice Strand
Mef2-RD 1430..2016 21..607 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:31:15 Download gff for BO01020.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 9921610..9921673 544..607 95   Plus
2R 9920519..9920722 340..543 100 <- Plus
2R 9919427..9919747 19..339 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:23:35 Download gff for BO01020.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5809115..5809178 544..607 95   Plus
arm_2R 5808024..5808227 340..543 100 <- Plus
arm_2R 5806932..5807252 19..339 100 <- Plus

BO01020.5prime Sequence

611 bp (610 high quality bases) assembled on 2005-11-30

> BO01020.5prime
GAAGTTATCAGTCGACATGGGCCGCAAAAAAATTCAAATATCACGCATCA
CCGATGAACGCAATCGGCAGGTGACCTTCAACAAGCGCAAGTTCGGCGTG
ATGAAGAAGGCCTACGAGCTGTCCGTGCTCTGCGACTGCGAGATCGCCCT
GATCATCTTCTCGTCGAGCAACAAGCTGTACCAGTACGCCAGCACCGACA
TGGATCGCGTCCTGCTCAAGTACACCGAGTACAACGAGCCCCACGAGTCC
CTCACCAACAAGAACATCATCGAGAAGGAGAACAAGAACGGCGTGATGTC
GCCGGACTCGCCCGAAGCCGAAACGGACTACACACTCACTCCGCGAACGG
AGGCCAAGTACAACAAGATCGACGAGGAGTTCCAGAACATGATGCAGCGC
AACCAGATGGCCATCGGCGGTGCGGGTGCCCCTCGCCAGCTTCCAAACAG
CAGCTACACGCTGCCCGTTTCTGTTCCGGTGCCGGGATCTTACGGCGACA
ACCTGCTGCAGGCCAGTCCACAGATGTCCCACACCAACATCAGCCCCCGT
CCATCGAGTTCGGAGACGGATTCAGGTGGGATGTCCCTGATAAGTGCAAG
CTTTCTAGACC

BO01020.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG1429-PE 582 Mef2-RE 1..579 17..595 2895 100 Plus
CG1429-PD 1623 Mef2-RD 1..577 17..593 2885 100 Plus
CG1429-PC 1548 Mef2-RC 1..577 17..593 2885 100 Plus
CG1429-PB 1530 Mef2-RB 1..559 17..575 2795 100 Plus
CG1429-PF 1506 Mef2-RF 1..559 17..575 2795 100 Plus
CG1429-PA 1551 Mef2-RA 1..559 17..575 2795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2-RG 5240 CG1429-RG 2460..3037 16..593 2890 100 Plus
Mef2-RC 5854 CG1429-RC 1056..1633 16..593 2890 100 Plus
Mef2-RD 3690 CG1429-RD 1439..2016 16..593 2890 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9919427..9919749 595..273 1615 100 Minus
2R 25286936 2R 9920519..9920725 274..68 1035 100 Minus
2R 25286936 2R 9921606..9921664 74..16 295 100 Minus
Blast to na_te.dros performed on 2015-02-11 23:41:49 has no hits.

BO01020.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:14 Download gff for BO01020.5prime
Subject Subject Range Query Range Percent Splice Strand
Mef2-PE 1..582 17..596 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:09 Download gff for BO01020.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1429-PE 1..582 17..596 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:30:46 Download gff for BO01020.5prime
Subject Subject Range Query Range Percent Splice Strand
Mef2-RD 1430..2016 7..593 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:54:30 Download gff for BO01020.5prime
Subject Subject Range Query Range Percent Splice Strand
Mef2-RD 1430..2016 7..593 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:54:30 Download gff for BO01020.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 9921610..9921673 7..70 95   Minus
2R 9920519..9920722 71..274 100 <- Minus
2R 9919427..9919747 275..595 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:30:46 Download gff for BO01020.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5809115..5809178 7..70 95   Minus
arm_2R 5808024..5808227 71..274 100 <- Minus
arm_2R 5806932..5807252 275..595 100 <- Minus

BO01020.complete Sequence

613 bp (613 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629391

> BO01020.complete
GAAGTTATCAGTCGACATGGGCCGCAAAAAAATTCAAATATCACGCATCA
CCGATGAACGCAATCGGCAGGTGACCTTCAACAAGCGCAAGTTCGGCGTG
ATGAAGAAGGCCTACGAGCTGTCCGTGCTCTGCGACTGCGAGATCGCCCT
GATCATCTTCTCGTCGAGCAACAAGCTGTACCAGTACGCCAGCACCGACA
TGGATCGCGTCCTGCTCAAGTACACCGAGTACAACGAGCCCCACGAGTCC
CTCACCAACAAGAACATCATCGAGAAGGAGAACAAGAACGGCGTGATGTC
GCCGGACTCGCCCGAAGCCGAAACGGACTACACACTCACTCCGCGAACGG
AGGCCAAGTACAACAAGATCGACGAGGAGTTCCAGAACATGATGCAGCGC
AACCAGATGGCCATCGGCGGTGCGGGTGCCCCTCGCCAGCTTCCAAACAG
CAGCTACACGCTGCCCGTTTCTGTTCCGGTGCCGGGATCTTACGGCGACA
ACCTGCTGCAGGCCAGTCCACAGATGTCCCACACCAACATCAGCCCCCGT
CCATCGAGTTCGGAGACGGATTCAGGTGGGATGTCCCTGATAAGTGCAAG
CTTTCTAGACCAT

BO01020.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2-RG 1536 CG1429-PG 1..577 17..593 2885 100 Plus
Mef2-RC 1548 CG1429-PC 1..577 17..593 2885 100 Plus
Mef2-RD 1623 CG1429-PD 1..577 17..593 2885 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2-RG 5240 CG1429-RG 2460..3037 16..593 2890 100 Plus
Mef2-RC 5854 CG1429-RC 1056..1633 16..593 2890 100 Plus
Mef2-RD 3690 CG1429-RD 1439..2016 16..593 2890 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9919427..9919749 595..273 1615 100 Minus
2R 25286936 2R 9920519..9920725 274..68 1035 100 Minus
2R 25286936 2R 9921606..9921664 74..16 295 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:39:28 has no hits.

BO01020.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:41 Download gff for BO01020.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RE 1..582 17..596 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:06:16 Download gff for BO01020.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RE 1016..1604 7..595 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:57:19 Download gff for BO01020.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RD 1440..2017 17..597 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:41 Download gff for BO01020.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RE 1016..1604 7..595 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:23:37 Download gff for BO01020.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RD 1440..2017 17..597 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:23:37 Download gff for BO01020.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9921610..9921663 17..70 100   Minus
2R 9920519..9920722 71..274 100 <- Minus
2R 9919425..9919747 275..597 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:57:19 Download gff for BO01020.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5809115..5809168 17..70 100   Minus
arm_2R 5808024..5808227 71..274 100 <- Minus
arm_2R 5806930..5807252 275..597 99 <- Minus

BO01020.pep Sequence

Translation from 16 to 613

> BO01020.pep
MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSS
SNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPE
AETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAGAPRQLPNSSYTLP
VSVPVPGSYGDNLLQASPQMSHTNISPRPSSSETDSGGMSLISASFLDH

BO01020.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2-PG 511 CG1429-PG 1..193 1..193 991 99.5 Plus
Mef2-PC 515 CG1429-PC 1..192 1..192 990 100 Plus
Mef2-PD 540 CG1429-PD 1..192 1..192 990 100 Plus
Mef2-PF 501 CG1429-PF 1..186 1..186 961 100 Plus
Mef2-PB 509 CG1429-PB 1..186 1..186 961 100 Plus