Clone BO01024 Report

Search the DGRC for BO01024

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptTaf12-RA
Protein status:BO01024.pep: full length peptide match
Sequenced Size:622

Clone Sequence Records

BO01024.5prime Sequence

620 bp (619 high quality bases) assembled on 2005-11-30

> BO01024.5prime
GAAGTTATCAGTCGACATGTCGGATCTCTTTACCACTTTCGATAGCAACG
GCGTCGCCGAGCACCACCTGCACCACAACCACAACTCCACATCGTCCGCC
AGCGGACTGCTCCACGACCCACCCATGGCCTCGCCCTCCCAGCACAGTCC
GATGACCAACAACAGCAACTCATCCTCGCAGAACGGCGGACCGGTTTCCG
GTTTGGGTACGGGAACGGGCCCCATATCTGGTGGTAGCAAGTCATCCAAT
CACACATCATCCGCCGCCGGTTCCGAGAACACTCCCATGCTTACCAAACC
GCGTCTCACAGAGCTCGTCCGAGAGGTGGATACCACCACGCAGCTGGACG
AGGATGTTGAGGAGCTTCTGCTTCAGATCATCGACGACTTTGTCGAGGAC
ACCGTCAAGTCGACGAGCGCCTTCGCCAAGCACCGAAAGTCTAACAAGAT
CGAGGTGCGCGACGTGCAGCTGCACTTTGAGCGGAAGTACAACATGTGGA
TACCCGGCTTCGGTACGGACGAACTGCGTCCCTACAAGCGGGCAGCTGTC
ACGGAGGCGCACAAACAGCGCCTTGCCCTCATACGGAAAACGATCAAGAA
ATACGCAAGCTTTCTAGACC

BO01024.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17358-PB 591 Taf12-RB 1..588 17..604 2940 100 Plus
CG17358-PC 591 Taf12-RC 1..588 17..604 2940 100 Plus
CG17358-PA 591 Taf12-RA 1..588 17..604 2940 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Taf12-RA 1234 CG17358-RA 478..1065 17..604 2940 100 Plus
Taf12-RB 1066 CG17358-RB 310..897 17..604 2940 100 Plus
Taf12-RE 897 CG17358-RE 170..728 46..604 2795 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11678555..11678872 604..287 1590 100 Minus
3R 32079331 3R 11678944..11679213 286..17 1350 100 Minus
Blast to na_te.dros performed on 2015-02-12 00:41:23 has no hits.

BO01024.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:19 Download gff for BO01024.5prime
Subject Subject Range Query Range Percent Splice Strand
Taf12-PA 1..591 17..605 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:20 Download gff for BO01024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17358-PA 1..591 17..605 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:31:40 Download gff for BO01024.5prime
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 306..897 10..604 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:09:42 Download gff for BO01024.5prime
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 306..897 10..604 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:09:42 Download gff for BO01024.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 11678944..11679217 10..286 98   Minus
3R 11678555..11678872 287..604 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:31:40 Download gff for BO01024.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7504666..7504939 10..286 98   Minus
arm_3R 7504277..7504594 287..604 100 <- Minus

BO01024.3prime Sequence

337 bp (253 high quality bases) assembled on 2005-11-30

> BO01024.3prime
ATGGTCTAGAAAGCTTGCGTATTTCTTGATCGTTTTCCGTATGAGGGCAA
GGCGCTGTTTGTGCGCCTCCGTGACAGCTGCCCGCTTGTAGGGACGCAGT
TCGTCCGTACCGAAGCCGGGTATCCACATGTTGTACTTCCGCTCAAAGTG
CAGCTGCACGTCGCGCACCTCGATCTTGTTAGACTTTCGGTGCTTGGCGA
AGGCGCTCGTCGACTTGACGGTGTCCTCGACAAAGTCGTCGATGATCTGA
AGCAGAAGCTCCCTCACATCCTCGTCCAGCTGCGTGGTGGTATCCACCTC
TCGGACGAGCTCTGTGAGACGCGGTTTGGTAAGCATG

BO01024.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG17358-PB 591 Taf12-RB 345..588 262..19 1220 100 Minus
CG17358-PC 591 Taf12-RC 345..588 262..19 1220 100 Minus
CG17358-PA 591 Taf12-RA 345..588 262..19 1220 100 Minus
CG17358-PB 591 Taf12-RB 270..341 337..266 360 100 Minus
CG17358-PC 591 Taf12-RC 270..341 337..266 360 100 Minus
CG17358-PA 591 Taf12-RA 270..341 337..266 360 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Taf12-RE 897 CG17358-RE 410..728 337..19 1550 99.4 Minus
Taf12-RD 852 CG17358-RD 365..683 337..19 1550 99.4 Minus
Taf12-RA 1234 CG17358-RA 747..1065 337..19 1550 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11678555..11678872 19..336 1545 99.1 Plus
Blast to na_te.dros performed on 2015-02-12 00:41:16 has no hits.

BO01024.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:18 Download gff for BO01024.3prime
Subject Subject Range Query Range Percent Splice Strand
Taf12-PA 270..591 18..337 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:18 Download gff for BO01024.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17358-PA 270..591 18..337 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:31:38 Download gff for BO01024.3prime
Subject Subject Range Query Range Percent Splice Strand
Taf12-RA 747..1065 19..337 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:09:19 Download gff for BO01024.3prime
Subject Subject Range Query Range Percent Splice Strand
Taf12-RA 747..1065 19..337 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:09:19 Download gff for BO01024.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 11678555..11678872 19..337 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:31:38 Download gff for BO01024.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7504277..7504594 19..337 99   Plus

BO01024.complete Sequence

622 bp (622 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629393

> BO01024.complete
GAAGTTATCAGTCGACATGTCGGATCTCTTTACCACTTTCGATAGCAACG
GCGTCGCCGAGCACCACCTGCACCACAACCACAACTCCACATCGTCCGCC
AGCGGACTGCTCCACGACCCACCCATGGCCTCGCCCTCCCAGCACAGTCC
GATGACCAACAACAGCAACTCATCCTCGCAGAACGGCGGACCGGTTTCCG
GTTTGGGTACGGGAACGGGCCCCATATCTGGTGGTAGCAAGTCATCCAAT
CACACATCATCCGCCGCCGGTTCCGAGAACACTCCCATGCTTACCAAACC
GCGTCTCACAGAGCTCGTCCGAGAGGTGGATACCACCACGCAGCTGGACG
AGGATGTTGAGGAGCTTCTGCTTCAGATCATCGACGACTTTGTCGAGGAC
ACCGTCAAGTCGACGAGCGCCTTCGCCAAGCACCGAAAGTCTAACAAGAT
CGAGGTGCGCGACGTGCAGCTGCACTTTGAGCGGAAGTACAACATGTGGA
TACCCGGCTTCGGTACGGACGAACTGCGTCCCTACAAGCGGGCAGCTGTC
ACGGAGGCGCACAAACAGCGCCTTGCCCTCATACGGAAAACGATCAAGAA
ATACGCAAGCTTTCTAGACCAT

BO01024.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Taf12-RA 591 CG17358-PA 1..588 17..604 2940 100 Plus
Taf12-RB 591 CG17358-PB 1..588 17..604 2940 100 Plus
Taf12-RE 483 CG17358-PE 1..480 125..604 2400 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Taf12-RA 1234 CG17358-RA 478..1065 17..604 2940 100 Plus
Taf12-RB 1066 CG17358-RB 310..897 17..604 2940 100 Plus
Taf12-RE 897 CG17358-RE 170..728 46..604 2795 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11678555..11678872 604..287 1590 100 Minus
3R 32079331 3R 11678944..11679213 286..17 1350 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:48:37 has no hits.

BO01024.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:25:29 Download gff for BO01024.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RA 1..591 17..605 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:50:15 Download gff for BO01024.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RA 422..1013 10..604 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:00:00 Download gff for BO01024.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 310..897 17..606 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:25:30 Download gff for BO01024.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RA 422..1013 10..604 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:26:54 Download gff for BO01024.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 310..897 17..606 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:26:54 Download gff for BO01024.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11678944..11679213 17..286 100   Minus
3R 11678553..11678872 287..606 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:00:00 Download gff for BO01024.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7504666..7504935 17..286 100   Minus
arm_3R 7504275..7504594 287..606 99 <- Minus

BO01024.pep Sequence

Translation from 16 to 622

> BO01024.pep
MSDLFTTFDSNGVAEHHLHHNHNSTSSASGLLHDPPMASPSQHSPMTNNS
NSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTPMLTKPRLTEL
VREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDV
QLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKKYASFL
DH

BO01024.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Taf12-PA 196 CG17358-PA 1..196 1..196 1018 100 Plus
Taf12-PB 196 CG17358-PB 1..196 1..196 1018 100 Plus
Taf12-PE 160 CG17358-PE 1..160 37..196 819 100 Plus
Taf12-PD 160 CG17358-PD 1..160 37..196 819 100 Plus