Clone BO01030 Report

Search the DGRC for BO01030

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG12071-RA
Protein status:BO01030.pep:
Sequenced Size:685

Clone Sequence Records

BO01030.5prime Sequence

683 bp (682 high quality bases) assembled on 2005-11-30

> BO01030.5prime
GAAGTTATCAGTCGACATGGATAAGATGACGGTTGCCCAGAAGAACGCAT
ATCTCGAGGCGCACATGGCGGTGCAGCAGCAGATGGCCCAGGCGGCCATT
CAGTTCAAGCAGCAGCAGACGTCCCAGCAACAGAACTCCCCCACGGCCAA
CAACAACAACAACAGCCAGAACAATGGCAACATGCAGCAGCAACAGCAGC
AGCAGCAGCAGCAACAGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAT
TATGCAGCAACCATCAAGGTGCCGCAGATCAGTTCCTCCAATGTGGCAGC
CGCGGCGGCGGGGGAGAGCACCTTCACAGTTCCGGACGACGGAATGGGAT
TCGAAGGAGGCGTGCGGGTCCTGCAGAGTCTGGGAACCTGGTCGGCGGCC
GAGCAACTGACCTACAACATCCCCAAGCCCAACCTCATCCCCTTCACAGA
GCCCTATGTCGAGGGGGGCTCCATGCACCCCGCCAGTCGACTCAAGGCCC
TGCAACAGGTGCAACAGGCATCCTCCGGGGTGCGCAAGACAAATCCCTCA
AAGTCCACCAACAAGGCATTCGAGTGCACGGTCTGCGGCAAAGGACTCGC
CCGCAAGGACAAGCTGACCATCCACATGCGCATCCACACCGGCGAGAAGC
CCTATATTTGTGAAGTAGCAAGCTTTCTAGACC

BO01030.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-PA 654 CG12071-RA 1..651 17..667 3255 100 Plus
CG12071-PB 1737 CG12071-RB 1..650 17..666 3250 100 Plus
CG6654-PA 1920 CG6654-RA 1287..1313 622..648 135 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-RE 2640 CG12071-RE 279..930 15..666 3260 100 Plus
CG12071-RD 2155 CG12071-RD 279..930 15..666 3260 100 Plus
CG12071-RG 2155 CG12071-RG 279..930 15..666 3260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30879354..30879893 554..15 2700 100 Minus
3R 32079331 3R 30879130..30879242 667..555 565 100 Minus
Blast to na_te.dros performed 2015-02-10 15:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2347..2510 108..277 348 72.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2456..2649 73..261 172 59.2 Plus

BO01030.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:26 Download gff for BO01030.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12071-PA 1..654 17..671 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:33 Download gff for BO01030.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12071-PA 1..654 17..671 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:32:40 Download gff for BO01030.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12071-RB 123..784 11..671 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:13:12 Download gff for BO01030.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12071-RG 275..936 11..671 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:13:12 Download gff for BO01030.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 30879354..30879897 11..554 99   Minus
3R 30879124..30879242 555..674 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:32:40 Download gff for BO01030.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26705076..26705619 11..554 99   Minus
arm_3R 26704846..26704964 555..674 98 <- Minus

BO01030.3prime Sequence

683 bp (682 high quality bases) assembled on 2005-11-30

> BO01030.3prime
ATGGTCTAGAAAGCTTGCTACTTCACAAATATAGGGCTTCTCGCCGGTGT
GGATGCGCATGTGGATGGTCAGCTTGTCCTTGCGGGCGAGTCCTTTGCCG
CAGACCGTGCACTCGAATGCCTTGTTGGTGGACTTTGAGGGATTTGTCTT
GCGCACCCCGGAGGATGCCTGTTGCACCTGTTGCAGGGCCTTGAGTCGAC
TGGCGGGGTGCATGGAGCCCCCCTCGACATAGGGCTCTGTGAAGGGGATG
AGGTTGGGCTTGGGGATGTTGTAGGTCAGTTGCTCGGCCGCCGACCAGGT
TCCCAGACTCTGCAGGACCCGCACGCCTCCTTCGAATCCCATTCCGTCGT
CCGGAACTGTGAAGGTGCTCTCCCCCGCCGCCGCGGCTGCCACATTGGAG
GAACTGATCTGCGGCACCTTGATGGTTGCTGCATAATGCTGCTGCTGCTG
TTGTTGCTGCTGCTGCTGCTGTTGCTGCTGCTGCTGCTGCTGTTGCTGCT
GCATGTTGCCATTGTTCTGGCTGTTGTTGTTGTTGTTGGCCGTGGGGGAG
TTCTGTTGCTGGGACGTCTGCTGCTGCTTGAACTGAATGGCCGCCTGGGC
CATCTGCTGCTGCACCGCCATGTGCGCCTCGAGATATGCGTTCTTCTGGG
CAACCGTCATCTTATCCATGTCGACTGATAACT

BO01030.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-PA 654 CG12071-RA 1..651 669..19 3255 100 Minus
CG12071-PB 1737 CG12071-RB 1..650 669..20 3250 100 Minus
CG6654-PA 1920 CG6654-RA 1287..1313 64..38 135 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-RE 2640 CG12071-RE 279..930 671..20 3260 100 Minus
CG12071-RD 2155 CG12071-RD 279..930 671..20 3260 100 Minus
CG12071-RG 2155 CG12071-RG 279..930 671..20 3260 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30879354..30879893 132..671 2700 100 Plus
3R 32079331 3R 30879130..30879242 19..131 565 100 Plus
Blast to na_te.dros performed 2015-02-12 10:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2347..2510 578..409 348 72.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2456..2649 613..425 172 59.2 Minus

BO01030.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:26 Download gff for BO01030.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12071-PA 1..654 15..669 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:31 Download gff for BO01030.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12071-PA 1..654 15..669 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:46:59 Download gff for BO01030.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12071-RB 123..784 15..675 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:07:29 Download gff for BO01030.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12071-RG 275..936 15..675 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:07:29 Download gff for BO01030.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 30879354..30879897 132..675 99   Plus
3R 30879124..30879242 12..131 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:46:59 Download gff for BO01030.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26705076..26705619 132..675 99   Plus
arm_3R 26704846..26704964 12..131 98 <- Plus

BO01030.complete Sequence

685 bp (685 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629395

> BO01030.complete
GAAGTTATCAGTCGACATGGATAAGATGACGGTTGCCCAGAAGAACGCAT
ATCTCGAGGCGCACATGGCGGTGCAGCAGCAGATGGCCCAGGCGGCCATT
CAGTTCAAGCAGCAGCAGACGTCCCAGCAACAGAACTCCCCCACGGCCAA
CAACAACAACAACAGCCAGAACAATGGCAACATGCAGCAGCAACAGCAGC
AGCAGCAGCAGCAACAGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAT
TATGCAGCAACCATCAAGGTGCCGCAGATCAGTTCCTCCAATGTGGCAGC
CGCGGCGGCGGGGGAGAGCACCTTCACAGTTCCGGACGACGGAATGGGAT
TCGAAGGAGGCGTGCGGGTCCTGCAGAGTCTGGGAACCTGGTCGGCGGCC
GAGCAACTGACCTACAACATCCCCAAGCCCAACCTCATCCCCTTCACAGA
GCCCTATGTCGAGGGGGGCTCCATGCACCCCGCCAGTCGACTCAAGGCCC
TGCAACAGGTGCAACAGGCATCCTCCGGGGTGCGCAAGACAAATCCCTCA
AAGTCCACCAACAAGGCATTCGAGTGCACGGTCTGCGGCAAAGGACTCGC
CCGCAAGGACAAGCTGACCATCCACATGCGCATCCACACCGGCGAGAAGC
CCTATATTTGTGAAGTAGCAAGCTTTCTAGACCAT

BO01030.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-RE 1746 CG12071-PE 1..650 17..666 3250 100 Plus
CG12071-RD 1746 CG12071-PD 1..650 17..666 3250 100 Plus
CG12071-RG 1017 CG12071-PG 1..650 17..666 3250 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-RE 2640 CG12071-RE 279..930 15..666 3260 100 Plus
CG12071-RD 2155 CG12071-RD 279..930 15..666 3260 100 Plus
CG12071-RG 2155 CG12071-RG 279..930 15..666 3260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30879354..30879893 554..15 2700 100 Minus
3R 32079331 3R 30879130..30879242 667..555 565 100 Minus
Blast to na_te.dros performed 2014-11-27 01:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2347..2510 108..277 348 72.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2456..2649 73..261 172 59.2 Plus

BO01030.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:23:12 Download gff for BO01030.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RA 1..654 17..671 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:56:58 Download gff for BO01030.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RA 123..785 11..674 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:16 Download gff for BO01030.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RB 129..779 17..669 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:23:12 Download gff for BO01030.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RA 123..785 11..674 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:27:24 Download gff for BO01030.complete
Subject Subject Range Query Range Percent Splice Strand
CG12071-RG 281..931 17..669 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:27:24 Download gff for BO01030.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30879354..30879891 17..554 100   Minus
3R 30879128..30879242 555..669 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:16 Download gff for BO01030.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26705076..26705613 17..554 100   Minus
arm_3R 26704850..26704964 555..669 98 <- Minus

BO01030.pep Sequence

Translation from 16 to 685

> BO01030.pep
MDKMTVAQKNAYLEAHMAVQQQMAQAAIQFKQQQTSQQQNSPTANNNNNS
QNNGNMQQQQQQQQQQQQQQQQQQQQQHYAATIKVPQISSSNVAAAAAGE
STFTVPDDGMGFEGGVRVLQSLGTWSAAEQLTYNIPKPNLIPFTEPYVEG
GSMHPASRLKALQQVQQASSGVRKTNPSKSTNKAFECTVCGKGLARKDKL
TIHMRIHTGEKPYICEVASFLDH

BO01030.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG12071-PG 338 CG12071-PG 1..219 1..219 1120 99.1 Plus
CG12071-PF 338 CG12071-PF 1..219 1..219 1120 99.1 Plus
CG12071-PE 581 CG12071-PE 1..219 1..219 1120 99.1 Plus
CG12071-PD 581 CG12071-PD 1..219 1..219 1120 99.1 Plus
Aef1-PB 308 CG5683-PB 29..216 38..217 182 30.3 Plus