Clone BO01032 Report

Search the DGRC for BO01032

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptOli-RA
Protein status:BO01032.pep: full length peptide match
Sequenced Size:730

Clone Sequence Records

BO01032.3prime Sequence

728 bp (727 high quality bases) assembled on 2005-11-30

> BO01032.3prime
ATGGTCTAGAAAGCTTGCACTGCTGCTAGTCGGTGGTTCGTTGTGAGGTC
CTTGAAGAAGAGCCTGCAACTTGGCAGCCGCCGGAAATGCACCCAAATCC
AGTGGCGCTGCTCCCGTGGTGCTTTGTATATAGGCCAAAAGTCTTCTCAA
CTCCTCGAGAGCATTTTGCTGCATCAGAATGTAGTTCTTAGCCAGCAGCA
AGGTGGCTATTTTCGACAGCTTTCGCACAGAAGGCGAATGGGCATAGGGA
ATCACACTTCTCAGCTCATCAAGGGCATCATTCAAATCGTGCATCCTTCG
TCGTTCCCGGGCATTTATGTTCAGCCTTACCGTCTTTCCCTGGCGGTTTT
TCTGCTTGCCACTGTTGGAGCCACTTCCGCTGGCGCCACCACTGGACACG
GCCACCGTGGTGGTGCCACCACTGATGGCAATGGCTGCGATGGCGGCGGC
CGTGGGACTCAATGGCTTCTCCGGAGCACTGGGCCCTGGTTTGTTCTCAT
CCGTCGGTGGCTGCTGGGACATGCCCATTCCCTGGGCATAGAAACCACCC
AGACCAACCGATCCAAGTGGCGTCCGACGGCCGGGGACGCTTTGTGGTGG
GCTGGCGGTGGGTGCTGGATGCTGGCCACCAAGCATATTGGCTGTAGGAG
GTATTGGCATGTGTCCGTGGTTGGGGAGACCGGGAAAACCAAAAGCAAGA
TTTGAGGGATCCATGTCGACTGATAACT

BO01032.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG5545-PA 699 Oli-RA 1..696 714..19 3455 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Oli-RC 1068 CG5545-RC 101..796 714..19 3465 99.9 Minus
Oli-RB 1174 CG5545-RB 207..902 714..19 3465 99.9 Minus
Oli-RD 1392 CG5545-RD 425..1120 714..19 3465 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17590240..17590811 714..143 2845 99.8 Minus
2L 23513712 2L 17590870..17590995 144..19 630 100 Minus
Blast to na_te.dros performed on 2015-02-13 16:08:52 has no hits.

BO01032.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:29 Download gff for BO01032.3prime
Subject Subject Range Query Range Percent Splice Strand
Oli-PA 1..699 15..714 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:38 Download gff for BO01032.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5545-PA 1..699 15..714 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:56:20 Download gff for BO01032.3prime
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 839..1537 15..714 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:33:42 Download gff for BO01032.3prime
Subject Subject Range Query Range Percent Splice Strand
Oli-RD 425..1123 15..714 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:33:42 Download gff for BO01032.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 17590872..17590998 15..142 98   Minus
2L 17590240..17590811 143..714 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:56:20 Download gff for BO01032.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17590872..17590998 15..142 98   Minus
arm_2L 17590240..17590811 143..714 99 -> Minus

BO01032.5prime Sequence

728 bp (727 high quality bases) assembled on 2005-11-30

> BO01032.5prime
GAAGTTATCAGTCGACATGGATCCCTCAAATCTTGCTTTTGGTTTTCCCG
GTCTCCCCAACCACGGACACATGCCAATACCTCCTACAGCCAATATGCTT
GGTGGCCAGCATCCAGCACCCACCGCCAGCCCACCACAAAGCGTCCCCGG
CCGTCGGACGCCACTTGGATCGGTTGGTCTGGGTGGTTTCTATGCCCAGG
GAATGGGCATGTCCCAGCAGCCACCGACGGATGAGAACAAACCAGGGCCC
AGTGCTCCGGAGAAGCCATTGAGTCCCACGGCCGCCGCCATCGCAGCCAT
TGCCATCAGTGGTGGCACCACCACGGTGGCCGTGTCCAGTGGTGGCGCCA
GCGGAAGTGGCTCCAACAGTGGCAAGCAGAAAAACCGCCAGGGAAAGACG
GTAAGGCTGAACATAAATGCCCGGGAACGACGAAGGATGCACGATTTGAA
TGATGCCCTTGATGAGCTGAGAAGTGTGATTCCCTATGCCCATTCGCCTT
CTGTGCGAAAGCTGTCGAAAATAGCCACCTTGCTGCTGGCTAAGAACTAC
ATTCTGATGCAGCAAAATGCTCTCGAGGAGTTGAGAAGACTTTTGGCCTA
TATACAAAGCACCACGGGAGCAGCGCCACTGGATTTGGGTGCATTTCCGG
CGGCTGCCAAGTTGCAGGCTCTTCTTCAAGGACCTCACAACGAACCACCG
ACTAGCAGCAGTGCAAGCTTTCTAGACC

BO01032.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG5545-PA 699 Oli-RA 1..696 17..712 3455 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Oli-RC 1068 CG5545-RC 101..796 17..712 3465 99.9 Plus
Oli-RB 1174 CG5545-RB 207..902 17..712 3465 99.9 Plus
Oli-RD 1392 CG5545-RD 425..1120 17..712 3465 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17590240..17590811 17..588 2845 99.8 Plus
2L 23513712 2L 17590870..17590995 587..712 630 100 Plus
Blast to na_te.dros performed on 2015-02-13 13:14:35 has no hits.

BO01032.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:30 Download gff for BO01032.5prime
Subject Subject Range Query Range Percent Splice Strand
Oli-PA 1..699 17..716 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:40 Download gff for BO01032.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5545-PA 1..699 17..716 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:32:43 Download gff for BO01032.5prime
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 839..1537 17..716 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:45:57 Download gff for BO01032.5prime
Subject Subject Range Query Range Percent Splice Strand
Oli-RD 425..1123 17..716 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:45:57 Download gff for BO01032.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 17590872..17590998 589..716 98   Plus
2L 17590240..17590811 17..588 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:32:43 Download gff for BO01032.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17590872..17590998 589..716 98   Plus
arm_2L 17590240..17590811 17..588 99 -> Plus

BO01032.complete Sequence

730 bp (730 high quality bases) assembled on 2005-06-24

GenBank Submission: FJ629396

> BO01032.complete
GAAGTTATCAGTCGACATGGATCCCTCAAATCTTGCTTTTGGTTTTCCCG
GTCTCCCCAACCACGGACACATGCCAATACCTCCTACAGCCAATATGCTT
GGTGGCCAGCATCCAGCACCCACCGCCAGCCCACCACAAAGCGTCCCCGG
CCGTCGGACGCCACTTGGATCGGTTGGTCTGGGTGGTTTCTATGCCCAGG
GAATGGGCATGTCCCAGCAGCCACCGACGGATGAGAACAAACCAGGGCCC
AGTGCTCCGGAGAAGCCATTGAGTCCCACGGCCGCCGCCATCGCAGCCAT
TGCCATCAGTGGTGGCACCACCACGGTGGCCGTGTCCAGTGGTGGCGCCA
GCGGAAGTGGCTCCAACAGTGGCAAGCAGAAAAACCGCCAGGGAAAGACG
GTAAGGCTGAACATAAATGCCCGGGAACGACGAAGGATGCACGATTTGAA
TGATGCCCTTGATGAGCTGAGAAGTGTGATTCCCTATGCCCATTCGCCTT
CTGTGCGAAAGCTGTCGAAAATAGCCACCTTGCTGCTGGCTAAGAACTAC
ATTCTGATGCAGCAAAATGCTCTCGAGGAGTTGAGAAGACTTTTGGCCTA
TATACAAAGCACCACGGGAGCAGCGCCACTGGATTTGGGTGCATTTCCGG
CGGCTGCCAAGTTGCAGGCTCTTCTTCAAGGACCTCACAACGAACCACCG
ACTAGCAGCAGTGCAAGCTTTCTAGACCAT

BO01032.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Oli-RC 699 CG5545-PC 1..696 17..712 3465 99.9 Plus
Oli-RB 699 CG5545-PB 1..696 17..712 3465 99.9 Plus
Oli-RD 699 CG5545-PD 1..696 17..712 3465 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Oli-RC 1068 CG5545-RC 101..796 17..712 3465 99.9 Plus
Oli-RB 1174 CG5545-RB 207..902 17..712 3465 99.9 Plus
Oli-RD 1392 CG5545-RD 425..1120 17..712 3465 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17590240..17590811 17..588 2845 99.8 Plus
2L 23513712 2L 17590870..17590995 587..712 630 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:30:31 has no hits.

BO01032.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:43:09 Download gff for BO01032.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 1..699 17..716 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:13:12 Download gff for BO01032.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 734..1432 17..716 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:04 Download gff for BO01032.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 839..1534 17..714 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:43:09 Download gff for BO01032.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 734..1432 17..716 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:13:16 Download gff for BO01032.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RD 425..1120 17..714 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:13:16 Download gff for BO01032.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17590872..17590995 589..714 98   Plus
2L 17590240..17590811 17..588 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:04 Download gff for BO01032.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17590872..17590995 589..714 98   Plus
arm_2L 17590240..17590811 17..588 99 -> Plus

BO01032.pep Sequence

Translation from 16 to 730

> BO01032.pep
MDPSNLAFGFPGLPNHGHMPIPPTANMLGGQHPAPTASPPQSVPGRRTPL
GSVGLGGFYAQGMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAISGG
TTTVAVSSGGASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDALDE
LRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQSTT
GAAPLDLGAFPAAAKLQALLQGPHNEPPTSSSASFLDH

BO01032.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Oli-PC 232 CG5545-PC 1..232 1..232 1194 100 Plus
Oli-PB 232 CG5545-PB 1..232 1..232 1194 100 Plus
Oli-PD 232 CG5545-PD 1..232 1..232 1194 100 Plus
Oli-PA 232 CG5545-PA 1..232 1..232 1194 100 Plus
dimm-PB 390 CG8667-PB 123..206 102..180 158 45.3 Plus