Clone BO01034 Report

Search the DGRC for BO01034

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptCG5846-RA
Protein status:BO01034.pep: full length peptide match
Sequenced Size:736

Clone Sequence Records

BO01034.5prime Sequence

734 bp (733 high quality bases) assembled on 2005-11-30

> BO01034.5prime
GAAGTTATCAGTCGACATGGTAGCACCAGCAAACACAATCCAAACTAATG
CGAATTCCGACGACGATGAGGGAGTGCGGTCGGCGCCTACCTCCATGCTG
GTGCTGGACGCCAAGCGGAAGAGCGCCTTCTTGCCGTACCGCCCCCAGTC
CACCGTGCTGACCAACTTGCAGCGCGGCAATACGGAGGCCACCTTTTGCC
CCGTCGAAGTTTCGCTCTCCTTTCACGAACGCGCTGGCCAAGGCGAGATC
ACGGAGGAGCAGGTGGCAGCGGAAAGAGCGCGTCAGCAGAACATTGATTA
CAAGGATGCACATGGTTTCACAGCCTTACATTGGGCAGCCTCCTACGGTC
AACTGGTTTCCGTGCAGCTCCTCGTCGCGGCTGGTGCCAATGTGAACACT
ATGGCTCCAGATTTGATTAGTCCTCTACTCCTAGCTGCCGCCGGTGGGCA
TAACGAGATCGTCCGCTTCTTGCTGGAACACGGCGCTGATTCGGGCCACA
TGGACATCGTTGGAAACACGGCGCTTATGTACGCAGCGGCCGGCAATCAT
CCGCATACTTGCAACGAGCTCCTGGCCAAAGACCTGGATCTAAGTGCCAC
CAACGAGGACGGAGACACGGCCTACTCGCTGGCCGTAGAGCATGGGGCTC
ATCTGGCGCAGGCGCTACTGGAGCAGTACATGACGGCCATAATCACAGCG
GGAGCCTTCGGTAGTATTGCAAGCTTTCTAGACC

BO01034.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-PA 705 CG5846-RA 1..702 17..718 3485 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-RB 952 CG5846-RB 171..872 17..718 3495 99.9 Plus
CG5846-RA 845 CG5846-RA 27..728 17..718 3495 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9956292..9956993 718..17 3495 99.9 Minus
Blast to na_te.dros performed on 2015-02-12 23:40:45 has no hits.

BO01034.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:34 Download gff for BO01034.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5846-PA 1..705 17..722 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:46 Download gff for BO01034.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5846-PA 1..705 17..722 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:20:11 Download gff for BO01034.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 27..733 17..726 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:22:33 Download gff for BO01034.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 27..733 17..726 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:22:33 Download gff for BO01034.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 9956287..9956995 16..726 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:20:11 Download gff for BO01034.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9956287..9956995 16..726 99 -> Minus

BO01034.3prime Sequence

734 bp (733 high quality bases) assembled on 2005-11-30

> BO01034.3prime
ATGGTCTAGAAAGCTTGCAATACTACCGAAGGCTCCCGCTGTGATTATGG
CCGTCATGTACTGCTCCAGTAGCGCCTGCGCCAGATGAGCCCCATGCTCT
ACGGCCAGCGAGTAGGCCGTGTCTCCGTCCTCGTTGGTGGCACTTAGATC
CAGGTCTTTGGCCAGGAGCTCGTTGCAAGTATGCGGATGATTGCCGGCCG
CTGCGTACATAAGCGCCGTGTTTCCAACGATGTCCATGTGGCCCGAATCA
GCGCCGTGTTCCAGCAAGAAGCGGACGATCTCGTTATGCCCACCGGCGGC
AGCTAGGAGTAGAGGACTAATCAAATCTGGAGCCATAGTGTTCACATTGG
CACCAGCCGCGACGAGGAGCTGCACGGAAACCAGTTGACCGTAGGAGGCT
GCCCAATGTAAGGCTGTGAAACCATGTGCATCCTTGTAATCAATGTTCTG
CTGACGCGCTCTTTCCGCTGCCACCTGCTCCTCCGTGATCTCGCCTTGGC
CAGCGCGTTCGTGAAAGGAGAGCGAAACTTCGACGGGGCAAAAGGTGGCC
TCCGTATTGCCGCGCTGCAAGTTGGTCAGCACGGTGGACTGGGGGCGGTA
CGGCAAGAAGGCGCTCTTCCGCTTGGCGTCCAGCACCAGCATGGAGGTAG
GCGCCGACCGCACTCCCTCATCGTCGTCGGAATTCGCATTAGTTTGGATT
GTGTTTGCTGGTGCTACCATGTCGACTGATAACT

BO01034.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-PA 705 CG5846-RA 1..702 720..19 3485 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-RB 952 CG5846-RB 171..872 720..19 3495 99.9 Minus
CG5846-RA 845 CG5846-RA 27..728 720..19 3495 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9956292..9956993 19..720 3495 99.9 Plus
Blast to na_te.dros performed on 2015-02-11 04:09:33 has no hits.

BO01034.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:33 Download gff for BO01034.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5846-PA 1..705 15..720 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:45 Download gff for BO01034.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5846-PA 1..705 15..720 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:42:41 Download gff for BO01034.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 27..733 11..720 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:43:13 Download gff for BO01034.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 27..733 11..720 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:43:13 Download gff for BO01034.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 9956287..9956995 11..721 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:42:41 Download gff for BO01034.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9956287..9956995 11..721 99 -> Plus

BO01034.complete Sequence

736 bp (736 high quality bases) assembled on 2005-06-24

GenBank Submission: FJ629397

> BO01034.complete
GAAGTTATCAGTCGACATGGTAGCACCAGCAAACACAATCCAAACTAATG
CGAATTCCGACGACGATGAGGGAGTGCGGTCGGCGCCTACCTCCATGCTG
GTGCTGGACGCCAAGCGGAAGAGCGCCTTCTTGCCGTACCGCCCCCAGTC
CACCGTGCTGACCAACTTGCAGCGCGGCAATACGGAGGCCACCTTTTGCC
CCGTCGAAGTTTCGCTCTCCTTTCACGAACGCGCTGGCCAAGGCGAGATC
ACGGAGGAGCAGGTGGCAGCGGAAAGAGCGCGTCAGCAGAACATTGATTA
CAAGGATGCACATGGTTTCACAGCCTTACATTGGGCAGCCTCCTACGGTC
AACTGGTTTCCGTGCAGCTCCTCGTCGCGGCTGGTGCCAATGTGAACACT
ATGGCTCCAGATTTGATTAGTCCTCTACTCCTAGCTGCCGCCGGTGGGCA
TAACGAGATCGTCCGCTTCTTGCTGGAACACGGCGCTGATTCGGGCCACA
TGGACATCGTTGGAAACACGGCGCTTATGTACGCAGCGGCCGGCAATCAT
CCGCATACTTGCAACGAGCTCCTGGCCAAAGACCTGGATCTAAGTGCCAC
CAACGAGGACGGAGACACGGCCTACTCGCTGGCCGTAGAGCATGGGGCTC
ATCTGGCGCAGGCGCTACTGGAGCAGTACATGACGGCCATAATCACAGCG
GGAGCCTTCGGTAGTATTGCAAGCTTTCTAGACCAT

BO01034.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-RB 705 CG5846-PB 1..702 17..718 3495 99.9 Plus
CG5846-RA 705 CG5846-PA 1..702 17..718 3495 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-RB 952 CG5846-RB 171..872 17..718 3495 99.9 Plus
CG5846-RA 845 CG5846-RA 27..728 17..718 3495 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9956292..9956993 718..17 3495 99.9 Minus
Blast to na_te.dros performed on 2014-11-27 07:46:12 has no hits.

BO01034.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:43:07 Download gff for BO01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 1..705 17..722 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:13:09 Download gff for BO01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 815..1521 17..726 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:22:20 Download gff for BO01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 27..728 17..720 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:43:07 Download gff for BO01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 815..1521 17..726 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:16:37 Download gff for BO01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG5846-RA 27..728 17..720 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:16:37 Download gff for BO01034.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9956290..9956993 17..720 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:22:20 Download gff for BO01034.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9956290..9956993 17..720 99   Minus

BO01034.pep Sequence

Translation from 16 to 736

> BO01034.pep
MVAPANTIQTNANSDDDEGVRSAPTSMLVLDAKRKSAFLPYRPQSTVLTN
LQRGNTEATFCPVEVSLSFHERAGQGEITEEQVAAERARQQNIDYKDAHG
FTALHWAASYGQLVSVQLLVAAGANVNTMAPDLISPLLLAAAGGHNEIVR
FLLEHGADSGHMDIVGNTALMYAAAGNHPHTCNELLAKDLDLSATNEDGD
TAYSLAVEHGAHLAQALLEQYMTAIITAGAFGSIASFLDH

BO01034.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG5846-PB 234 CG5846-PB 1..234 1..234 1192 100 Plus
CG5846-PA 234 CG5846-PA 1..234 1..234 1192 100 Plus
Ilk-PA 448 CG10504-PA 31..154 97..220 177 35.7 Plus
CG42672-PL 1476 CG42672-PL 146..293 73..221 165 32.7 Plus
CG42672-PD 1478 CG42672-PD 146..293 73..221 165 32.7 Plus