Clone BO01035 Report

Search the DGRC for BO01035

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:35
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO01035.pep:
Sequenced Size:793

Clone Sequence Records

BO01035.3prime Sequence

791 bp (790 high quality bases) assembled on 2005-11-30

> BO01035.3prime
ATGGTCTAGAAAGCTTGCGTTGGTCACAAACTCAAACTCCTCCTCCTCAC
GTTCCCGCTTGACGGCCACTCCAACGCCAGATGATCCTCCTCCTCCTCCT
CCTCCGCTGGCACTTCCTGCTCCCGAACCGGATGCGCCAGCGATGCTGCC
CACGGCCGCCGCATCGCTGTCCACCTCCATCTTGAGATCTCCGCCGGCGC
CGGTGCTCTCGCTCTTAACCTCCTGACCACCGCCGCCCCCAGATCCGCCG
GAGCTGCCCACCGTTTTCGTTGTCGTAGTGGTGGTAAACTTGATGACGGG
CTTGGGAATGGTCACCACCTGCTGCTTGGCCACCACGGAGTGTGGCCTCT
TCGGACCATTGGCGCTGGAGACGGGCTTAACGACGGTCTTCAGTGGACGG
CCCTCCACCGCCGACTTGGTCATTTTCTTGGGCTGATTAGTGGCCCGCAG
TTTGTAGTTGACGCCGGTGAGACAGTAGCGGTCGGGCGGCAGTCGGAGAC
CGCAGTGCGGCTTAATGGGTGGCAGGGGCATGCTGTTGCGCACGTCGGCC
ACCTTGGCTAGAACGTGGCGCTCCAACGGCCCGGTGAAGCTCTTGTCCAG
CGTAACCTCGGTGGCCAGACGCACGTCGTCCAAGTCGATGGTCTTCTTGC
GCGCATGGTTGGCGTACACCTTGGCGTCGTCCAGAATGCAGGTTACATAG
CGGAAGGTGAACTCCAGCAGTTGGTTGACCACGCGCGGCTCGTACTCCTG
GACATTCAGCTCCTTCAGGATGGACATGTCGACTGATAACT

BO01035.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6474-PA 837 e(y)1-RA 75..834 778..19 3800 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 05:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)1-RA 1124 CG6474-RA 173..932 778..19 3800 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 05:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17842474..17843156 701..19 3415 100 Minus
X 23542271 X 17842333..17842410 778..701 390 100 Minus
Blast to na_te.dros performed 2015-02-13 05:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Doc4-element 2791 Doc4-element DOC4 2791bp 1457..1487 69..99 110 83.9 Plus

BO01035.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:35 Download gff for BO01035.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6474-PA 70..837 18..783 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:47 Download gff for BO01035.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6474-PA 70..837 18..783 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 17:49:11 Download gff for BO01035.3prime
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 168..936 13..783 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 07:56:38 Download gff for BO01035.3prime
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 168..936 13..783 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 07:56:38 Download gff for BO01035.3prime
Subject Subject Range Query Range Percent Splice Strand
X 17842474..17843160 13..701 99   Minus
X 17842328..17842409 702..783 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 17:49:11 Download gff for BO01035.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 17736507..17737193 13..701 99   Minus
arm_X 17736361..17736442 702..783 97 -> Minus

BO01035.5prime Sequence

791 bp (790 high quality bases) assembled on 2005-11-30

> BO01035.5prime
GAAGTTATCAGTCGACATGTCCATCCTGAAGGAGCTGAATGTCCAGGAGT
ACGAGCCGCGCGTGGTCAACCAACTGCTGGAGTTCACCTTCCGCTATGTA
ACCTGCATTCTGGACGACGCCAAGGTGTACGCCAACCATGCGCGCAAGAA
GACCATCGACTTGGACGACGTGCGTCTGGCCACCGAGGTTACGCTGGACA
AGAGCTTCACCGGGCCGTTGGAGCGCCACGTTCTAGCCAAGGTGGCCGAC
GTGCGCAACAGCATGCCCCTGCCACCCATTAAGCCGCACTGCGGTCTCCG
ACTGCCGCCCGACCGCTACTGTCTCACCGGCGTCAACTACAAACTGCGGG
CCACTAATCAGCCCAAGAAAATGACCAAGTCGGCGGTGGAGGGCCGTCCA
CTGAAGACCGTCGTTAAGCCCGTCTCCAGCGCCAATGGTCCGAAGAGGCC
ACACTCCGTGGTGGCCAAGCAGCAGGTGGTGACCATTCCCAAGCCCGTCA
TCAAGTTTACCACCACTACGACAACGAAAACGGTGGGCAGCTCCGGCGGA
TCTGGGGGCGGCGGTGGTCAGGAGGTTAAGAGCGAGAGCACCGGCGCCGG
CGGAGATCTCAAGATGGAGGTGGACAGCGATGCGGCGGCCGTGGGCAGCA
TCGCTGGCGCATCCGGTTCGGGAGCAGGAAGTGCCAGCGGAGGAGGAGGA
GGAGGAGGATCATCTGGCGTTGGAGTGGCCGTCAAGCGGGAACGTGAGGA
GGAGGAGTTTGAGTTTGTGACAAACGCAAGCTTTCTAGACC

BO01035.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG6474-PA 837 e(y)1-RA 75..830 16..771 3780 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)1-RA 1124 CG6474-RA 173..932 16..775 3785 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17842474..17843156 93..775 3400 99.9 Plus
X 23542271 X 17842333..17842410 16..93 390 100 Plus
Blast to na_te.dros performed 2015-02-12 00:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
Doc4-element 2791 Doc4-element DOC4 2791bp 1457..1487 725..695 110 83.9 Minus

BO01035.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:36 Download gff for BO01035.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6474-PA 70..837 11..776 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:49 Download gff for BO01035.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6474-PA 70..837 11..776 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:31:43 Download gff for BO01035.5prime
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 168..936 11..781 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:10:23 Download gff for BO01035.5prime
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 168..936 11..781 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:10:23 Download gff for BO01035.5prime
Subject Subject Range Query Range Percent Splice Strand
X 17842474..17843160 93..781 99   Plus
X 17842328..17842409 11..92 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:31:43 Download gff for BO01035.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 17736507..17737193 93..781 99   Plus
arm_X 17736361..17736442 11..92 97 -> Plus

BO01035.complete Sequence

793 bp (793 high quality bases) assembled on 2005-06-23

> BO01035.complete
GAAGTTATCAGTCGACATGTCCATCCTGAAGGAGCTGAATGTCCAGGAGT
ACGAGCCGCGCGTGGTCAACCAACTGCTGGAGTTCACCTTCCGCTATGTA
ACCTGCATTCTGGACGACGCCAAGGTGTACGCCAACCATGCGCGCAAGAA
GACCATCGACTTGGACGACGTGCGTCTGGCCACCGAGGTTACGCTGGACA
AGAGCTTCACCGGGCCGTTGGAGCGCCACGTTCTAGCCAAGGTGGCCGAC
GTGCGCAACAGCATGCCCCTGCCACCCATTAAGCCGCACTGCGGTCTCCG
ACTGCCGCCCGACCGCTACTGTCTCACCGGCGTCAACTACAAACTGCGGG
CCACTAATCAGCCCAAGAAAATGACCAAGTCGGCGGTGGAGGGCCGTCCA
CTGAAGACCGTCGTTAAGCCCGTCTCCAGCGCCAATGGTCCGAAGAGGCC
ACACTCCGTGGTGGCCAAGCAGCAGGTGGTGACCATTCCCAAGCCCGTCA
TCAAGTTTACCACCACTACGACAACGAAAACGGTGGGCAGCTCCGGCGGA
TCTGGGGGCGGCGGTGGTCAGGAGGTTAAGAGCGAGAGCACCGGCGCCGG
CGGAGATCTCAAGATGGAGGTGGACAGCGATGCGGCGGCCGTGGGCAGCA
TCGCTGGCGCATCCGGTTCGGGAGCAGGAAGTGCCAGCGGAGGAGGAGGA
GGAGGAGGATCATCTGGCGTTGGAGTGGCCGTCAAGCGGGAACGTGAGGA
GGAGGAGTTTGAGTTTGTGACCAACGCAAGCTTTCTAGACCAT

BO01035.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)1-RA 837 CG6474-PA 75..834 16..775 3800 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)1-RA 1124 CG6474-RA 173..932 16..775 3800 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17842474..17843156 93..775 3415 100 Plus
X 23542271 X 17842333..17842410 16..93 390 100 Plus
Blast to na_te.dros performed 2014-11-27 07:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Doc4-element 2791 Doc4-element DOC4 2791bp 1457..1487 725..695 110 83.9 Minus

BO01035.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:43 Download gff for BO01035.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 70..837 11..776 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:47 Download gff for BO01035.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 154..922 11..781 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:27:53 Download gff for BO01035.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 174..932 17..777 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:44 Download gff for BO01035.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 154..922 11..781 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:08:07 Download gff for BO01035.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 174..932 17..777 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:08:07 Download gff for BO01035.complete
Subject Subject Range Query Range Percent Splice Strand
X 17842474..17843156 93..777 99   Plus
X 17842334..17842409 17..92 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:27:53 Download gff for BO01035.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17736507..17737189 93..777 99   Plus
arm_X 17736367..17736442 17..92 100 -> Plus

BO01035.pep Sequence

Translation from 16 to 793

> BO01035.pep
MSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDAKVYANHARKKTIDLD
DVRLATEVTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLRLPPDR
YCLTGVNYKLRATNQPKKMTKSAVEGRPLKTVVKPVSSANGPKRPHSVVA
KQQVVTIPKPVIKFTTTTTTKTVGSSGGSGGGGGQEVKSESTGAGGDLKM
EVDSDAAAVGSIAGASGSGAGSASGGGGGGGSSGVGVAVKREREEEEFEF
VTNASFLDH

BO01035.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)1-PA 278 CG6474-PA 26..278 1..253 1293 100 Plus