Clone BO01037 Report

Search the DGRC for BO01037

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:37
Vector:pDNR-Dual
Associated Gene/Transcriptbigmax-RA
Protein status:BO01037.pep:
Sequenced Size:796

Clone Sequence Records

BO01037.3prime Sequence

794 bp (793 high quality bases) assembled on 2005-11-30

> BO01037.3prime
ATGGTCTAGAAAGCTTGCGCTGAAACCCTCGCTCGACTCCTGCTCCATGG
CCTGAAGTTCCTGTTTTTCCATAGCCTCCTGCGCCATTTGCTGCAAGGTA
CGACTGAGTATGTTGCGCAGGATGTGCGGCTTGCAGTGCTCCTCCAGCCA
GGGGATAATGCCGGTGGTCAGCTGCTTAAAGTTCTCCATGGGTATGTGTT
GAAATGTCTCGAACATTTCCTCCATAATTGCCTGGAACACTTGAAACTTG
GCCTCATCGGTGAGGCGTGCCTCCTCCGGCCCTGGATTCGCCTGCTGATG
CTGTAGCATGTTCTCATAGCCGTTCTTAATGATCCGTAACGCTGTTACCT
CCTTCTGTAGCGCCGATCCCTCGTCCTCCTGCTTGAGTTTCTGCTGGTTA
AGGTAGCCAATGTATTCGATGGACTTCTGCAGGATCAGAGCCTTGCTGAG
CTTGTAGCCGGAGGAGTCGTTGGGCTGGCAGCGCGGCACCAGCTCCTGCA
GACTGTCGTAGCCCTTCTTGATGGCATCGCGCCGCTTCTGCTCCGCCTGG
GTGTGCGCCTCCCTTCTCCGCTCCTTGTAACTCAGCGTGGAATTGGCGGC
CGCGGAATGGCGCGCATCGCCGCTATCGTCGTCGTCGTCTGAATTGTGCG
CCGAGGAGTTCGGAGTGTGCGTGCTGCCCGCACTGCTGCACCGCGAGTAG
TGCTTGCTGGTGTGGTCCTGGTCGTGCTCCATGCCGAAAACGTCTTCCTT
GGTGGCCAACGCGTTGTTATTATCGCTCATGTCGACTGATAACT

BO01037.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG3350-PA 765 bigmax-RA 1..762 780..19 3710 99.4 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 15:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
bigmax-RA 954 CG3350-RA 49..819 788..19 3755 99.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 15:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27287785..27288188 238..641 1975 99.3 Plus
3R 32079331 3R 27287501..27287720 19..238 1085 99.5 Plus
3R 32079331 3R 27288328..27288469 639..780 710 100 Plus
Blast to na_te.dros performed on 2015-02-12 15:58:51 has no hits.

BO01037.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:38 Download gff for BO01037.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3350-PA 1..765 16..780 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:54 Download gff for BO01037.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3350-PA 1..765 16..780 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:23:38 Download gff for BO01037.3prime
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 49..819 19..788 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:32:16 Download gff for BO01037.3prime
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 49..819 19..788 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:32:16 Download gff for BO01037.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 27288328..27288478 639..788 98   Plus
3R 27287785..27288185 238..638 99 <- Plus
3R 27287501..27287719 19..237 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:23:38 Download gff for BO01037.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23114050..23114200 639..788 98   Plus
arm_3R 23113507..23113907 238..638 99 <- Plus
arm_3R 23113223..23113441 19..237 99 <- Plus

BO01037.5prime Sequence

794 bp (705 high quality bases) assembled on 2005-11-29

> BO01037.5prime
GAAGTTATCAGTCGACATGAGCGATAATAACAACGCGTTGGCCACCAAGG
AAGACGTTTTCGGCATGGAGCACGACCAGGACCACACCAGCAAGCACTAC
TCGCGGTGCAGCAGTGCGGGCAGCACGCACACTCCGAACTCCTCGGCGCA
CAATTCAGACGACGACGACGATAGCGGCGATGCGCGCCATTCCGCGGCCG
CCAATTCCACGCTGAGTTACAAGGAGCGGAGAAGGGAGGCGCACACCCAG
GCGGAGCAGAAGCGGCGCGATGCCATCAAGAAGGGCTACGACAGTCTGCA
GGAGCTGGTGCCGCGCTGCCAGCCCAACGACTCCTCCGGCTACAAGCTCA
GCAAGGCTCTGATCCTGCAGAAGTCCATCGAATACATTGGCTACCTTAAC
CAGCAGAAACTCAAGCAGGAGGACGAGGGATCGGCGCTACAGAAGGAGGT
AACAGCGTTACGGATCATTAAGAACGGCTATGAGAACATGCTACAGCATC
AGCAGGCGAATCCAGGGCCGGAGGAGGCACGCCTCACCGATGAGGCCAAG
TTTCAAGTGTTCCAGGCAATTATGGAGGAAATGTTCGAGACATTTCAACA
CATACCCATGGAGAACTTTAAGCAGCTGACCACCGGCATTATCCCCTGGC
TGGAGGAGCACTGCAAGCCGCACATCCTGCGCAACATACTCAGTCGTACC
TTGCAGCAAATGGCGCAGGAGGCTATGGAAAAACAGGAACTTCAGGCCAT
GGAGCAGGAGTCGAGCGAGGGTTTCAGCGCAAGCTTTCTAGACC

BO01037.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG3350-PA 765 bigmax-RA 1..762 17..778 3710 99.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
bigmax-RA 954 CG3350-RA 49..819 9..778 3755 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27287785..27288188 559..156 1975 99.3 Minus
3R 32079331 3R 27287501..27287720 778..559 1085 99.5 Minus
3R 32079331 3R 27288328..27288469 158..17 710 100 Minus
Blast to na_te.dros performed on 2015-02-12 05:41:42 has no hits.

BO01037.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:39 Download gff for BO01037.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3350-PA 1..765 17..781 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:14:55 Download gff for BO01037.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3350-PA 1..765 17..781 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:16:52 Download gff for BO01037.5prime
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 49..819 9..778 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:39:51 Download gff for BO01037.5prime
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 49..819 9..778 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:39:51 Download gff for BO01037.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 27288328..27288478 9..158 98   Minus
3R 27287785..27288185 159..559 99 <- Minus
3R 27287501..27287719 560..778 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:16:52 Download gff for BO01037.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23114050..23114200 9..158 98   Minus
arm_3R 23113507..23113907 159..559 99 <- Minus
arm_3R 23113223..23113441 560..778 99 <- Minus

BO01037.complete Sequence

796 bp (796 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629398

> BO01037.complete
GAAGTTATCAGTCGACATGAGCGATAATAACAACGCGTTGGCCACCAAGG
AAGACGTTTTCGGCATGGAGCACGACCAGGACCACACCAGCAAGCACTAC
TCGCGGTGCAGCAGTGCGGGCAGCACGCACACTCCGAACTCCTCGGCGCA
CAATTCAGACGACGACGACGATAGCGGCGATGCGCGCCATTCCGCGGCCG
CCAATTCCACGCTGAGTTACAAGGAGCGGAGAAGGGAGGCGCACACCCAG
GCGGAGCAGAAGCGGCGCGATGCCATCAAGAAGGGCTACGACAGTCTGCA
GGAGCTGGTGCCGCGCTGCCAGCCCAACGACTCCTCCGGCTACAAGCTCA
GCAAGGCTCTGATCCTGCAGAAGTCCATCGAATACATTGGCTACCTTAAC
CAGCAGAAACTCAAGCAGGAGGACGAGGGATCGGCGCTACAGAAGGAGGT
AACAGCGTTACGGATCATTAAGAACGGCTATGAGAACATGCTACAGCATC
AGCAGGCGAATCCAGGGCCGGAGGAGGCACGCCTCACCGATGAGGCCAAG
TTTCAAGTGTTCCAGGCAATTATGGAGGAAATGTTCGAGACATTTCAACA
CATACCCATGGAGAACTTTAAGCAGCTGACCACCGGCATTATCCCCTGGC
TGGAGGAGCACTGCAAGCCGCACATCCTGCGCAACATACTCAGTCGTACC
TTGCAGCAAATGGCGCAGGAGGCTATGGAAAAACAGGAACTTCAGGCCAT
GGAGCAGGAGTCGAGCGAGGGTTTCAGCGCAAGCTTTCTAGACCAT

BO01037.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
bigmax-RA 765 CG3350-PA 1..762 17..778 3750 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
bigmax-RA 954 CG3350-RA 58..819 17..778 3750 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27287785..27288188 559..156 1975 99.3 Minus
3R 32079331 3R 27287501..27287720 778..559 1085 99.5 Minus
3R 32079331 3R 27288328..27288469 158..17 710 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:10:52 has no hits.

BO01037.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:45 Download gff for BO01037.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 1..765 17..781 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:49 Download gff for BO01037.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 18..788 9..778 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:04:22 Download gff for BO01037.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 58..819 17..780 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:45 Download gff for BO01037.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 18..788 9..778 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:16:35 Download gff for BO01037.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 58..819 17..780 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:16:35 Download gff for BO01037.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27288328..27288469 17..158 100   Minus
3R 27287785..27288185 159..559 99 <- Minus
3R 27287498..27287719 560..780 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:04:22 Download gff for BO01037.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23114050..23114191 17..158 100   Minus
arm_3R 23113507..23113907 159..559 99 <- Minus
arm_3R 23113220..23113441 560..780 98 <- Minus

BO01037.pep Sequence

Translation from 16 to 796

> BO01037.pep
MSDNNNALATKEDVFGMEHDQDHTSKHYSRCSSAGSTHTPNSSAHNSDDD
DDSGDARHSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYDSLQELVPR
CQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRI
IKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETFQHIPMEN
FKQLTTGIIPWLEEHCKPHILRNILSRTLQQMAQEAMEKQELQAMEQESS
EGFSASFLDH

BO01037.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
bigmax-PA 254 CG3350-PA 1..254 1..254 1318 100 Plus
Mio-PE 925 CG18362-PE 690..891 39..233 173 26.9 Plus
Mio-PM 1119 CG18362-PM 884..1085 39..233 173 26.9 Plus
Mio-PL 1119 CG18362-PL 884..1085 39..233 173 26.9 Plus
Mio-PK 1119 CG18362-PK 884..1085 39..233 173 26.9 Plus