Clone BO01040 Report

Search the DGRC for BO01040

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptEts65A-RB
Protein status:BO01040.pep: full length peptide match
Sequenced Size:805

Clone Sequence Records

BO01040.3prime Sequence

803 bp (802 high quality bases) assembled on 2005-11-30

> BO01040.3prime
ATGGTCTAGAAAGCTTGCTGCGTAGTGGGGATAGCTGCTCAGGTGGGGCG
CTACGTGGGAGGGGGTCACGTGGCTCATCGAGTGCGGCTGGTAGAGATTC
GTGGCCGGACTGCCCCAGTTGCCCCACGAGGCGGCCGACGGGAAGATCGA
GGCCGAGGATGAGGTCATGCCATGATGCGGACTCATGAACGAGCTGAGCT
TGGCGCTGTGGTGATATGGTGTCATGAACAAGTCGCTCTGGTATTTGTAG
GTGGGATCGCTGGCCGCCGGCTGAGTAGCAGCTGCCAGGCCTTGGAAATC
GAATTTGTACGCATACCGCTTGCCGTGCACCTTGGTCATTATATTTTTGT
CGTAGTAGTACCTCAAGGCGCGACTGAGCTTATCGTAGTTCATGTTGGGC
TTGGACTTCCTCTCGCCCCAGCGGCGGGCGACCTCGTCGGGATCGGTTAG
CTTAAACTCGCCGTTGGTGCCCTCCCAGGTGATGCAGCTGGCGTTATTGG
AGTCCGAGAGCAGCTCGAGAAGGAACTGCCACAGCTGGATTTGGCCAGAG
CCTGAGCTGGCCAGTCTGCTGCTGGTGGGTCCGAACATTTGATATGGATC
AGGTTGCCGTAGTTGTGAGTGCGGATCATGTTTGATGCCCAGGGCGTTCG
AGCTGTAACCTTGCGATTGTGTCGAACTGTGGGAGCCCCACGACGATTTG
TACGAGGAATCTGCGAAGAGCATCGAGAAGTTGCTGAAGCTGCCCGTGGA
GCGTGACAAGTAATCGGCGGAGGACTTGATGTCCAGCATGTCGACTGATA
ACT

BO01040.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG7018-PB 774 Ets65A-RB 1..771 789..19 3855 100 Minus
CG7018-PA 1473 Ets65A-RA 779..1470 710..19 3460 100 Minus
CG2914-PA 1428 Ets21C-RA 940..998 363..305 170 91.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-RB 2177 CG7018-RB 654..1424 789..19 3855 100 Minus
Ets65A-RE 4190 CG7018-RE 1695..2386 710..19 3460 100 Minus
Ets65A-RD 4190 CG7018-RD 1695..2386 710..19 3460 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 18:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6121492..6121702 363..153 1055 100 Minus
3L 28110227 3L 6118956..6119150 554..360 975 100 Minus
3L 28110227 3L 6121975..6122109 153..19 675 100 Minus
3L 28110227 3L 6112120..6112198 789..711 395 100 Minus
3L 28110227 3L 6114292..6114353 661..600 310 100 Minus
3L 28110227 3L 6112368..6112423 713..658 280 100 Minus
2L 23513712 2L 547993..548162 377..546 280 77.6 Plus
3L 28110227 3L 6115954..6116003 600..551 250 100 Minus
2L 23513712 2L 547825..547902 286..363 240 87.2 Plus
Blast to na_te.dros performed on 2015-02-11 18:12:03 has no hits.

BO01040.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:42 Download gff for BO01040.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7018-PB 1..774 16..789 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:00 Download gff for BO01040.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7018-PB 1..774 16..789 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:46:49 Download gff for BO01040.3prime
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 654..1424 19..789 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:42:41 Download gff for BO01040.3prime
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 654..1424 19..789 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:42:41 Download gff for BO01040.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 6121976..6122109 19..152 100   Minus
3L 6121494..6121702 153..361 100 -> Minus
3L 6118959..6119148 362..551 100 -> Minus
3L 6115955..6116002 552..599 100 -> Minus
3L 6114294..6114353 600..659 100 -> Minus
3L 6112371..6112421 660..710 100 -> Minus
3L 6112120..6112198 711..789 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:46:49 Download gff for BO01040.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6115076..6115209 19..152 100   Minus
arm_3L 6114594..6114802 153..361 100 -> Minus
arm_3L 6112059..6112248 362..551 100 -> Minus
arm_3L 6109055..6109102 552..599 100 -> Minus
arm_3L 6107394..6107453 600..659 100 -> Minus
arm_3L 6105471..6105521 660..710 100 -> Minus
arm_3L 6105220..6105298 711..789 100 -> Minus

BO01040.5prime Sequence

803 bp (678 high quality bases) assembled on 2005-11-29

> BO01040.5prime
GAAGTTATCAGTCGACATGCTGGACATCAAGTCCTCCGCCGATTACTTGT
CACGCTCCACGGGCAGCTTCAGCAACTTCTCGATGCTCTTCGCAGATTCC
TCGTACAAATCGTCGTGGGGCTCCCACAGTTCGACACAATCGCAAGGTTA
CAGCTCGAACGCCCTGGGCATCAAACATGATCCGCACTCACAACTACGGC
AACCTGATCCATATCAAATGTTCGGACCCACCAGCAGCAGACTGGCCAGC
TCAGGCTCTGGCCAAATCCAGCTGTGGCAGTTCCTTCTCGAGCTGCTCTC
GGACTCCAATAACGCCAGCTGCATCACCTGGGAGGGCACCAACGGCGAGT
TTAAGCTAACCGATCCCGACGAGGTCGCCCGCCGCTGGGGCGAGAGGAAG
TCCAAGCCCAACATGAACTACGATAAGCTCAGTCGCGCCTTGAGGTACTA
CTACGACAAAAATATAATGACCAAGGTGCACGGCAAGCGGTATGCGTACA
AATTCGATTTCCAAGGCCTGGCAGCTGCTACTCAGCCGGCGGCCAGCGAT
CCCACCTACAAATACCAGAGCGACTTGTTCATGACACCATATCACCACAG
CGCCAAGCTCAGCTCGTTCATGAGTCCGCATCATGGCATGACCTCATCCT
CGGCCTCGATCTTCCCGTCGGCCGCCTCGTGGGGCAACTGGGGCAGTCCG
GCCACGAATCTCTACCAGCCGCACTCGATGAGCCACGTGACCTCCTCCCA
CGTAGCGCCCCACCTGAGCAGCTATCCCCACTACGCAGCAAGCTTTCTAG
ACC

BO01040.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG7018-PB 774 Ets65A-RB 1..771 17..787 3830 99.8 Plus
CG7018-PA 1473 Ets65A-RA 779..1470 96..787 3435 99.8 Plus
CG2914-PA 1428 Ets21C-RA 940..998 443..501 170 91.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-RB 2177 CG7018-RB 654..1424 17..787 3840 99.9 Plus
Ets65A-RE 4190 CG7018-RE 1695..2386 96..787 3445 99.9 Plus
Ets65A-RD 4190 CG7018-RD 1695..2386 96..787 3445 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6121492..6121702 443..653 1055 100 Plus
3L 28110227 3L 6118956..6119150 252..446 975 100 Plus
3L 28110227 3L 6121975..6122109 653..787 660 99.3 Plus
3L 28110227 3L 6112120..6112198 17..95 395 100 Plus
3L 28110227 3L 6114292..6114353 145..206 310 100 Plus
3L 28110227 3L 6112368..6112423 93..148 280 100 Plus
2L 23513712 2L 547993..548162 429..260 280 77.6 Minus
3L 28110227 3L 6115954..6116003 206..255 250 100 Plus
2L 23513712 2L 547825..547902 520..443 240 87.2 Minus
Blast to na_te.dros performed on 2015-02-12 10:08:41 has no hits.

BO01040.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:43 Download gff for BO01040.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7018-PB 1..774 17..790 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:02 Download gff for BO01040.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7018-PB 1..774 17..790 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:47:02 Download gff for BO01040.5prime
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 654..1424 17..787 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:07:44 Download gff for BO01040.5prime
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 654..1424 17..787 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:07:44 Download gff for BO01040.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 6121976..6122109 654..787 99   Plus
3L 6121494..6121702 445..653 100 -> Plus
3L 6118959..6119148 255..444 100 -> Plus
3L 6115955..6116002 207..254 100 -> Plus
3L 6114294..6114353 147..206 100 -> Plus
3L 6112371..6112421 96..146 100 -> Plus
3L 6112120..6112198 17..95 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:47:02 Download gff for BO01040.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6115076..6115209 654..787 99   Plus
arm_3L 6114594..6114802 445..653 100 -> Plus
arm_3L 6112059..6112248 255..444 100 -> Plus
arm_3L 6109055..6109102 207..254 100 -> Plus
arm_3L 6107394..6107453 147..206 100 -> Plus
arm_3L 6105471..6105521 96..146 100 -> Plus
arm_3L 6105220..6105298 17..95 100 -> Plus

BO01040.complete Sequence

805 bp (805 high quality bases) assembled on 2005-06-23

GenBank Submission: KX796878

> BO01040.complete
GAAGTTATCAGTCGACATGCTGGACATCAAGTCCTCCGCCGATTACTTGT
CACGCTCCACGGGCAGCTTCAGCAACTTCTCGATGCTCTTCGCAGATTCC
TCGTACAAATCGTCGTGGGGCTCCCACAGTTCGACACAATCGCAAGGTTA
CAGCTCGAACGCCCTGGGCATCAAACATGATCCGCACTCACAACTACGGC
AACCTGATCCATATCAAATGTTCGGACCCACCAGCAGCAGACTGGCCAGC
TCAGGCTCTGGCCAAATCCAGCTGTGGCAGTTCCTTCTCGAGCTGCTCTC
GGACTCCAATAACGCCAGCTGCATCACCTGGGAGGGCACCAACGGCGAGT
TTAAGCTAACCGATCCCGACGAGGTCGCCCGCCGCTGGGGCGAGAGGAAG
TCCAAGCCCAACATGAACTACGATAAGCTCAGTCGCGCCTTGAGGTACTA
CTACGACAAAAATATAATGACCAAGGTGCACGGCAAGCGGTATGCGTACA
AATTCGATTTCCAAGGCCTGGCAGCTGCTACTCAGCCGGCGGCCAGCGAT
CCCACCTACAAATACCAGAGCGACTTGTTCATGACACCATATCACCACAG
CGCCAAGCTCAGCTCGTTCATGAGTCCGCATCATGGCATGACCTCATCCT
CGGCCTCGATCTTCCCGTCGGCCGCCTCGTGGGGCAACTGGGGCAGTCCG
GCCACGAATCTCTACCAGCCGCACTCGATGAGCCACGTGACCCCCTCCCA
CGTAGCGCCCCACCTGAGCAGCTATCCCCACTACGCAGCAAGCTTTCTAG
ACCAT

BO01040.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-RB 774 CG7018-PB 1..771 17..787 3855 100 Plus
Ets65A-RE 2187 CG7018-PE 779..1470 96..787 3460 100 Plus
Ets65A-RD 1974 CG7018-PD 779..1470 96..787 3460 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-RB 2177 CG7018-RB 654..1424 17..787 3855 100 Plus
Ets65A-RE 4190 CG7018-RE 1695..2386 96..787 3460 100 Plus
Ets65A-RD 4190 CG7018-RD 1695..2386 96..787 3460 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6121492..6121702 443..653 1055 100 Plus
3L 28110227 3L 6118956..6119150 252..446 975 100 Plus
3L 28110227 3L 6121975..6122109 653..787 675 100 Plus
3L 28110227 3L 6112120..6112198 17..95 395 100 Plus
3L 28110227 3L 6114292..6114353 145..206 310 100 Plus
3L 28110227 3L 6112368..6112423 93..148 280 100 Plus
2L 23513712 2L 547993..548162 429..260 280 77.6 Minus
3L 28110227 3L 6115954..6116003 206..255 250 100 Plus
2L 23513712 2L 547825..547902 520..443 240 87.2 Minus
Blast to na_te.dros performed on 2014-11-27 13:09:00 has no hits.

BO01040.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:46 Download gff for BO01040.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 1..774 17..790 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:50 Download gff for BO01040.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 906..1676 17..787 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:27:11 Download gff for BO01040.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 654..1424 17..789 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:46 Download gff for BO01040.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 906..1676 17..787 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:11:58 Download gff for BO01040.complete
Subject Subject Range Query Range Percent Splice Strand
Ets65A-RB 654..1424 17..789 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:11:58 Download gff for BO01040.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6121976..6122109 654..789 98   Plus
3L 6121494..6121702 445..653 100 -> Plus
3L 6118959..6119148 255..444 100 -> Plus
3L 6115955..6116002 207..254 100 -> Plus
3L 6114294..6114353 147..206 100 -> Plus
3L 6112371..6112421 96..146 100 -> Plus
3L 6112120..6112198 17..95 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:27:11 Download gff for BO01040.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6115076..6115209 654..789 98   Plus
arm_3L 6114594..6114802 445..653 100 -> Plus
arm_3L 6112059..6112248 255..444 100 -> Plus
arm_3L 6109055..6109102 207..254 100 -> Plus
arm_3L 6107394..6107453 147..206 100 -> Plus
arm_3L 6105471..6105521 96..146 100 -> Plus
arm_3L 6105220..6105298 17..95 100 -> Plus

BO01040.pep Sequence

Translation from 16 to 805

> BO01040.pep
MLDIKSSADYLSRSTGSFSNFSMLFADSSYKSSWGSHSSTQSQGYSSNAL
GIKHDPHSQLRQPDPYQMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNA
SCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNI
MTKVHGKRYAYKFDFQGLAAATQPAASDPTYKYQSDLFMTPYHHSAKLSS
FMSPHHGMTSSSASIFPSAASWGNWGSPATNLYQPHSMSHVTPSHVAPHL
SSYPHYAASFLDH

BO01040.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
Ets65A-PB 257 CG7018-PB 1..257 1..257 1382 100 Plus
Ets65A-PA 490 CG7018-PA 261..490 28..257 1250 100 Plus
Ets65A-PC 512 CG7018-PC 283..512 28..257 1250 100 Plus
Ets65A-PD 657 CG7018-PD 261..490 28..257 1250 100 Plus
Ets65A-PE 728 CG7018-PE 261..490 28..257 1250 100 Plus