Clone BO01042 Report

Search the DGRC for BO01042

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptTFAM-RA
Protein status:BO01042.pep:
Sequenced Size:805

Clone Sequence Records

BO01042.3prime Sequence

803 bp (747 high quality bases) assembled on 2005-11-30

> BO01042.3prime
ATGGTCTAGAAAGCTTGCTATATCTTTGGAGGCCAGCGTCTTGCGGGGCT
TTGGCTCAGGTGGATCGATAAGATTTCCGTGACGCACCACGTCGATGTGG
CCCAGGCGGATCATCTTCTCCTCCCAAACGGAAATCGCTTTCCTGTAGAG
CTCCATCTCCTTGCGCGACTCCTGCATGTAGACCTCCTTCTCGGAGTCGG
AAAGGCGAGTCCACTTGGCGGTGGTCTTTTGGTGCCACTCGCGGTAGGTT
TGCTTGTCGCCCTGCGGAGTGTTGATACGTTCGCTGGCGATGAATCGCAG
GAAGGCCGAAGCGGGCTTTTTGGGTCGCCCCAGCTCCTTGACCCGCTTGC
GCAGCTGGCGGCGCTCCTTGGCGTCAACGAGGTCCTGCTTGAGCTGCTTG
ATCTCGGCCCGCTGCTCCTCCGTGAGTGTGGCATCGTACTTTGTTCGCTC
CTCCACGTAGATTTGTTGGTCCCGCTTGAACTCGGCCTGCAGGCGCTCCT
TCAGCTGCGCATCGGCATCGGACCAGTTCTTAGACAGCTGGCGCACCACC
TCGACGGTGGTAATCTGGGGATTGGCAGCCTTCAGCTTGGGCCGCTGCTC
CCGCATGAAGCGAAAGTAGGGAGTCAGCGGTTTCTTTGGTCGCGGCGGCA
GGCCCAACTGCTCCTCCAGGGTCTTCGACGGCACCGCCGGAGTGTTGCTG
ATGCTGGCGGCTGCTAGGGGCCTGACTTTGTTGATCAGCGAGCCGATGAG
GCCGCCGCGCGAGGACATCAGTGTTGTGGTGTAGATCATGTCGACTGATA
ACT

BO01042.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG4217-PA 774 TFAM-RA 1..771 789..19 3855 100 Minus
CG4217-PB 855 TFAM-RB 148..852 723..19 3525 100 Minus
CG4217-PB 855 TFAM-RB 1..70 789..720 350 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
TFAM-RA 1055 CG4217-RA 137..908 790..19 3860 100 Minus
TFAM-RB 1242 CG4217-RB 285..989 723..19 3525 100 Minus
TFAM-RB 1242 CG4217-RB 137..207 790..720 355 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20576145..20576726 142..723 2910 100 Plus
3R 32079331 3R 20575498..20575623 19..144 630 100 Plus
3R 32079331 3R 20576804..20576874 720..790 355 100 Plus
Blast to na_te.dros performed on 2015-02-12 10:08:45 has no hits.

BO01042.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:44 Download gff for BO01042.3prime
Subject Subject Range Query Range Percent Splice Strand
TFAM-PA 1..774 18..789 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:04 Download gff for BO01042.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4217-PA 1..774 18..789 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:47:04 Download gff for BO01042.3prime
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 137..913 11..790 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:07:50 Download gff for BO01042.3prime
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 137..913 11..790 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:07:50 Download gff for BO01042.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 20576806..20576874 722..790 100   Plus
3R 20576146..20576724 143..721 100 <- Plus
3R 20575493..20575621 11..142 96 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:47:04 Download gff for BO01042.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16402528..16402596 722..790 100   Plus
arm_3R 16401868..16402446 143..721 100 <- Plus
arm_3R 16401215..16401343 11..142 96 <- Plus

BO01042.5prime Sequence

803 bp (779 high quality bases) assembled on 2005-11-30

> BO01042.5prime
GAAGTTATCAGTCGACATGATCTACACCACAACACTGATGTCCTCGCGCG
GCGGCCTCATCGGCTCGCTGATCAACAAAGTCAGGCCCCTAGCAGCCGCC
AGCATCAGCAACACTCCGGCGGTGCCGTCGAAGACCCTGGAGGAGCAGTT
GGGCCTGCCGCCGCGACCAAAGAAACCGCTGACTCCCTACTTTCGCTTCA
TGCGGGAGCAGCGGCCCAAGCTGAAGGCTGCCAATCCCCAGATTACCACC
GTCGAGGTGGTGCGCCAGCTGTCTAAGAACTGGTCCGATGCCGATGCGCA
GCTGAAGGAGCGCCTGCAGGCCGAGTTCAAGCGGGACCAACAAATCTACG
TGGAGGAGCGAACAAAGTACGATGCCACACTCACGGAGGAGCAGCGGGCC
GAGATCAAGCAGCTCAAGCAGGACCTCGTTGACGCCAAGGAGCGCCGCCA
GCTGCGCAAGCGGGTCAAGGAGCTGGGGCGACCCAAAAAGCCCGCTTCGG
CCTTCCTGCGATTCATCGCCAGCGAACGTATCAACACTCCGCAGGGCGAC
AAGCAAACCTACCGCGAGTGGCACCAAAAGACCACCGCCAAGTGGACTCG
CCTTTCCGACTCCGAGAAGGAGGTCTACATGCAGGAGTCGCGCAAGGAGA
TGGAGCTCTACAGGAAAGCGATTTCCGTTTGGGAGGAGAAGATGATCCGC
CTGGGCCACATCGACGTGGTGCGTCACGGAAATCTTATCGATCCACCTGA
GCCAAAGCCCCGCAAGACGCTGGCCTCCAAAGATATAGCAAGCTTTCTAG
ACC

BO01042.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG4217-PA 774 TFAM-RA 1..771 17..787 3855 100 Plus
CG4217-PB 855 TFAM-RB 148..852 83..787 3525 100 Plus
CG4217-PB 855 TFAM-RB 1..70 17..86 350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
TFAM-RA 1055 CG4217-RA 137..908 16..787 3860 100 Plus
TFAM-RB 1242 CG4217-RB 285..989 83..787 3525 100 Plus
TFAM-RB 1242 CG4217-RB 137..207 16..86 355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20576145..20576726 664..83 2910 100 Minus
3R 32079331 3R 20575498..20575623 787..662 630 100 Minus
3R 32079331 3R 20576804..20576874 86..16 355 100 Minus
Blast to na_te.dros performed on 2015-02-12 10:08:51 has no hits.

BO01042.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:45 Download gff for BO01042.5prime
Subject Subject Range Query Range Percent Splice Strand
TFAM-PA 1..774 17..788 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:05 Download gff for BO01042.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4217-PA 1..774 17..788 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:47:06 Download gff for BO01042.5prime
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 137..913 16..795 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:08:02 Download gff for BO01042.5prime
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 137..913 16..795 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:08:02 Download gff for BO01042.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 20576806..20576874 16..84 100   Minus
3R 20576146..20576724 85..663 100 <- Minus
3R 20575493..20575621 664..795 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:47:06 Download gff for BO01042.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16402528..16402596 16..84 100   Minus
arm_3R 16401868..16402446 85..663 100 <- Minus
arm_3R 16401215..16401343 664..795 96 <- Minus

BO01042.complete Sequence

805 bp (805 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629399

> BO01042.complete
GAAGTTATCAGTCGACATGATCTACACCACAACACTGATGTCCTCGCGCG
GCGGCCTCATCGGCTCGCTGATCAACAAAGTCAGGCCCCTAGCAGCCGCC
AGCATCAGCAACACTCCGGCGGTGCCGTCGAAGACCCTGGAGGAGCAGTT
GGGCCTGCCGCCGCGACCAAAGAAACCGCTGACTCCCTACTTTCGCTTCA
TGCGGGAGCAGCGGCCCAAGCTGAAGGCTGCCAATCCCCAGATTACCACC
GTCGAGGTGGTGCGCCAGCTGTCTAAGAACTGGTCCGATGCCGATGCGCA
GCTGAAGGAGCGCCTGCAGGCCGAGTTCAAGCGGGACCAACAAATCTACG
TGGAGGAGCGAACAAAGTACGATGCCACACTCACGGAGGAGCAGCGGGCC
GAGATCAAGCAGCTCAAGCAGGACCTCGTTGACGCCAAGGAGCGCCGCCA
GCTGCGCAAGCGGGTCAAGGAGCTGGGGCGACCCAAAAAGCCCGCTTCGG
CCTTCCTGCGATTCATCGCCAGCGAACGTATCAACACTCCGCAGGGCGAC
AAGCAAACCTACCGCGAGTGGCACCAAAAGACCACCGCCAAGTGGACTCG
CCTTTCCGACTCCGAGAAGGAGGTCTACATGCAGGAGTCGCGCAAGGAGA
TGGAGCTCTACAGGAAAGCGATTTCCGTTTGGGAGGAGAAGATGATCCGC
CTGGGCCACATCGACGTGGTGCGTCACGGAAATCTTATCGATCCACCTGA
GCCAAAGCCCCGCAAGACGCTGGCCTCCAAAGATATAGCAAGCTTTCTAG
ACCAT

BO01042.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
TFAM-RA 774 CG4217-PA 1..771 17..787 3855 100 Plus
TFAM-RB 855 CG4217-PB 148..852 83..787 3525 100 Plus
TFAM-RB 855 CG4217-PB 1..70 17..86 350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
TFAM-RA 1055 CG4217-RA 137..908 16..787 3860 100 Plus
TFAM-RB 1242 CG4217-RB 285..989 83..787 3525 100 Plus
TFAM-RB 1242 CG4217-RB 137..207 16..86 355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20576145..20576726 664..83 2910 100 Minus
3R 32079331 3R 20575498..20575623 787..662 630 100 Minus
3R 32079331 3R 20576804..20576874 86..16 355 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:23:36 has no hits.

BO01042.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:47 Download gff for BO01042.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 1..774 17..788 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:53 Download gff for BO01042.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 146..922 16..795 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:52:48 Download gff for BO01042.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 138..908 17..789 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:47 Download gff for BO01042.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 146..922 16..795 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:24:35 Download gff for BO01042.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 138..908 17..789 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:24:35 Download gff for BO01042.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20576806..20576873 17..84 100   Minus
3R 20576146..20576724 85..663 100 <- Minus
3R 20575496..20575621 664..789 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:52:48 Download gff for BO01042.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16402528..16402595 17..84 100   Minus
arm_3R 16401868..16402446 85..663 100 <- Minus
arm_3R 16401218..16401343 664..789 98 <- Minus

BO01042.pep Sequence

Translation from 16 to 805

> BO01042.pep
MIYTTTLMSSRGGLIGSLINKVRPLAAASISNTPAVPSKTLEEQLGLPPR
PKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERL
QAEFKRDQQIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRV
KELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSE
KEVYMQESRKEMELYRKAISVWEEKMIRLGHIDVVRHGNLIDPPEPKPRK
TLASKDIASFLDH

BO01042.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
TFAM-PA 257 CG4217-PA 1..257 1..257 1314 100 Plus
TFAM-PB 284 CG4217-PB 1..284 1..257 1276 90.5 Plus