Clone BO01046 Report

Search the DGRC for BO01046

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:46
Vector:pDNR-Dual
Associated Gene/Transcriptsvp-RC
Protein status:BO01046.pep: full length peptide match
Sequenced Size:877

Clone Sequence Records

BO01046.3prime Sequence

870 bp (813 high quality bases) assembled on 2005-11-30

> BO01046.3prime
ATGGTCTAGAAAGCTTGCCATCGAAGGCAGATAGGGCCAGGAGAAACTGT
TGCCGCTCAGCAGCATATCGCGTATCAGCGTTTCAATTGGCGTTTTTCCG
ACTAGACGCACAAAAAACAATTGCTCAATGACTTGTGAGGAGACCGTTCG
CAGCGATGGCAGTCTGAGAAGCAGCTTGCCGAATCTCGTGGGCTGGTTGG
GATACTGGGTCCGGCAGTATTCCTCGAGGGCGCACTGCGACTTCTCTTGC
AGGGATTCAATGTGCGTCACATCGGACAGGCCGCAGGCATCGGTGGTGAA
GAGCACGATCGCCTTGAGGCAGGAGTACTCCGCGGAGTCGACATGCAGCG
CCTTCAGCTTCTCCACCTGCTCCTGGAAGATGCGGATGTGGTCCATGAAG
GCCACCACACGATCGGCGGCCATCGGGGAGGCATGAAGTCCGGCGGCGGC
CAGCAGTGGCGCCACATGGAGCGGCATGGAGCACTGGCTGGCGTTTAGGA
CGAAGAGCTCTGACCAGACGAGCCGGAGCAGGGCCACCTGGTCGGTCACC
TGCAGCTCCGGGAAGAAGGGTATGTTCTTGGCCCACTCGACCGCCGAGAA
GAGCAGTCGGGCGGCCAGTTCGCAGATGTTGTCGATGCCCATAATGTTGT
TGGGTTGCATGCACTGGCCATATCGCGAAGTCGGATACGGTTCCGCCCGC
AGCAGGAGCGAGATGTAGGAACTGAGGTACGAGTGCCCGTTAAAGCCGGC
AATGCCCATGGGATCCCCGTTGGCAATCTGGTACTGCCCATGCATGCCGG
CCAGACCGGGCTGAGTGGGTGGTACGCGTCCACGTTGAACAGCTTCGCGT
CTCATGCCCATGTCGACTGA

BO01046.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG11502-PC 846 svp-RC 1..843 861..19 4215 100 Minus
CG11502-PB 1632 svp-RB 787..1629 861..19 4215 100 Minus
CG11502-PA 2241 svp-RA 787..1357 861..291 2855 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
svp-RE 3859 CG11502-RE 1230..2072 861..19 4215 100 Minus
svp-RB 3859 CG11502-RB 1230..2072 861..19 4215 100 Minus
svp-RC 2876 CG11502-RC 247..1089 861..19 4215 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12294006..12294559 844..291 2770 100 Minus
3R 32079331 3R 12300478..12300638 291..131 805 100 Minus
3R 32079331 3R 12300885..12300998 132..19 570 100 Minus
Blast to na_te.dros performed on 2015-02-04 18:42:39 has no hits.

BO01046.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:51 Download gff for BO01046.3prime
Subject Subject Range Query Range Percent Splice Strand
svp-PC 1..846 16..861 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:18 Download gff for BO01046.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11502-PB 780..1632 16..869 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:10:53 Download gff for BO01046.3prime
Subject Subject Range Query Range Percent Splice Strand
svp-RC 240..1089 19..869 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:25:59 Download gff for BO01046.3prime
Subject Subject Range Query Range Percent Splice Strand
svp-RC 240..1089 19..869 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:25:59 Download gff for BO01046.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 12300885..12300998 19..132 100   Minus
3R 12300479..12300636 133..290 100 -> Minus
3R 12294008..12294559 291..842 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:10:53 Download gff for BO01046.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8126607..8126720 19..132 100   Minus
arm_3R 8126201..8126358 133..290 100 -> Minus
arm_3R 8119730..8120281 291..842 100 -> Minus

BO01046.5prime Sequence

876 bp (836 high quality bases) assembled on 2005-11-30

> BO01046.5prime
GAAGTTATCAGTCGACATGGGCATGAGACGCGAAGCTGTTCAACGTGGAC
GCGTACCACCCACTCAGCCCGGTCTGGCCGGCATGCATGGGCAGTACCAG
ATTGCCAACGGGGATCCCATGGGCATTGCCGGCTTTAACGGGCACTCGTA
CCTCAGTTCCTACATCTCGCTCCTGCTGCGGGCGGAACCGTATCCGACTT
CGCGATATGGCCAGTGCATGCAACCCAACAACATTATGGGCATCGACAAC
ATCTGCGAACTGGCCGCCCGACTGCTCTTCTCGGCGGTCGAGTGGGCCAA
GAACATACCCTTCTTCCCGGAGCTGCAGGTGACCGACCAGGTGGCCCTGC
TCCGGCTCGTCTGGTCAGAGCTCTTCGTCCTAAACGCCAGCCAGTGCTCC
ATGCCGCTCCATGTGGCGCCACTGCTGGCCGCCGCCGGACTTCATGCCTC
CCCGATGGCCGCCGATCGTGTGGTGGCCTTCATGGACCACATCCGCATCT
TCCAGGAGCAGGTGGAGAAGCTGAAGGCGCTGCATGTCGACTCCGCGGAG
TACTCCTGCCTCAAGGCGATCGTGCTCTTCACCACCGATGCCTGCGGCCT
GTCCGATGTGACGCACATTGAATCCCTGCAAGAGAAGTCGCAGTGCGCCC
TCGAGGAATACTGCCGGACCCAGTATCCCAACCAGCCCACGAGATTCGGC
AAGCTGCTTCTCAGACTGCCATCGCTGCGAACGGTCTCCTCACAAGTCAT
TGAGCAATTGTTTTTTGTGCGTCTAGTCGGAAAAACGCCAATTGAAACGC
TGATACGCGATATGCTGCTGAGCGGCAACAGTTTCTCCTGGCCCTATCTG
CCTTCGATGGCAAGCTTTCTAGACCA

BO01046.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG11502-PC 846 svp-RC 1..843 17..859 4215 100 Plus
CG11502-PB 1632 svp-RB 787..1629 17..859 4215 100 Plus
CG11502-PA 2241 svp-RA 787..1357 17..587 2855 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
svp-RE 3859 CG11502-RE 1230..2072 17..859 4215 100 Plus
svp-RB 3859 CG11502-RB 1230..2072 17..859 4215 100 Plus
svp-RC 2876 CG11502-RC 247..1089 17..859 4215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12294006..12294559 34..587 2770 100 Plus
3R 32079331 3R 12300478..12300638 587..747 805 100 Plus
3R 32079331 3R 12300885..12300998 746..859 570 100 Plus
Blast to na_te.dros performed on 2015-02-11 04:15:19 has no hits.

BO01046.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:52 Download gff for BO01046.5prime
Subject Subject Range Query Range Percent Splice Strand
svp-PC 1..846 17..862 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:19 Download gff for BO01046.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11502-PB 782..1632 12..862 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 05:00:15 Download gff for BO01046.5prime
Subject Subject Range Query Range Percent Splice Strand
svp-RC 242..1089 12..859 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:03:41 Download gff for BO01046.5prime
Subject Subject Range Query Range Percent Splice Strand
svp-RC 242..1089 12..859 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:03:41 Download gff for BO01046.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 12300885..12300998 746..859 100   Plus
3R 12300479..12300636 588..745 100 -> Plus
3R 12294008..12294559 36..587 100 -> Plus
3R 12290335..12290358 12..35 91 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 05:00:15 Download gff for BO01046.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8126607..8126720 746..859 100   Plus
arm_3R 8126201..8126358 588..745 100 -> Plus
arm_3R 8119730..8120281 36..587 100 -> Plus
arm_3R 8116057..8116080 12..35 91 -> Plus

BO01046.complete Sequence

877 bp (877 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629401

> BO01046.complete
GAAGTTATCAGTCGACATGGGCATGAGACGCGAAGCTGTTCAACGTGGAC
GCGTACCACCCACTCAGCCCGGTCTGGCCGGCATGCATGGGCAGTACCAG
ATTGCCAACGGGGATCCCATGGGCATTGCCGGCTTTAACGGGCACTCGTA
CCTCAGTTCCTACATCTCGCTCCTGCTGCGGGCGGAACCGTATCCGACTT
CGCGATATGGCCAGTGCATGCAACCCAACAACATTATGGGCATCGACAAC
ATCTGCGAACTGGCCGCCCGACTGCTCTTCTCGGCGGTCGAGTGGGCCAA
GAACATACCCTTCTTCCCGGAGCTGCAGGTGACCGACCAGGTGGCCCTGC
TCCGGCTCGTCTGGTCAGAGCTCTTCGTCCTAAACGCCAGCCAGTGCTCC
ATGCCGCTCCATGTGGCGCCACTGCTGGCCGCCGCCGGACTTCATGCCTC
CCCGATGGCCGCCGATCGTGTGGTGGCCTTCATGGACCACATCCGCATCT
TCCAGGAGCAGGTGGAGAAGCTGAAGGCGCTGCATGTCGACTCCGCGGAG
TACTCCTGCCTCAAGGCGATCGTGCTCTTCACCACCGATGCCTGCGGCCT
GTCCGATGTGACGCACATTGAATCCCTGCAAGAGAAGTCGCAGTGCGCCC
TCGAGGAATACTGCCGGACCCAGTATCCCAACCAGCCCACGAGATTCGGC
AAGCTGCTTCTCAGACTGCCATCGCTGCGAACGGTCTCCTCACAAGTCAT
TGAGCAATTGTTTTTTGTGCGTCTAGTCGGAAAAACGCCAATTGAAACGC
TGATACGCGATATGCTGCTGAGCGGCAACAGTTTCTCCTGGCCCTATCTG
CCTTCGATGGCAAGCTTTCTAGACCAT

BO01046.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
svp-RE 1665 CG11502-PE 787..1629 17..859 4215 100 Plus
svp-RB 1632 CG11502-PB 787..1629 17..859 4215 100 Plus
svp-RC 846 CG11502-PC 1..843 17..859 4215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
svp-RE 3859 CG11502-RE 1230..2072 17..859 4215 100 Plus
svp-RB 3859 CG11502-RB 1230..2072 17..859 4215 100 Plus
svp-RC 2876 CG11502-RC 247..1089 17..859 4215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12294006..12294559 34..587 2770 100 Plus
3R 32079331 3R 12300478..12300638 587..747 805 100 Plus
3R 32079331 3R 12300885..12300998 746..859 570 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:37:36 has no hits.

BO01046.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:01 Download gff for BO01046.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RB 782..1632 12..862 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:00:52 Download gff for BO01046.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RB 1230..2072 17..861 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:24 Download gff for BO01046.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RC 247..1089 17..861 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:01 Download gff for BO01046.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RB 1225..2072 12..859 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:21:49 Download gff for BO01046.complete
Subject Subject Range Query Range Percent Splice Strand
svp-RC 247..1089 17..861 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:21:49 Download gff for BO01046.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12300885..12300998 746..861 98   Plus
3R 12300479..12300636 588..745 100 -> Plus
3R 12294008..12294559 36..587 100 -> Plus
3R 12290340..12290358 17..35 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:24 Download gff for BO01046.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8126607..8126720 746..861 98   Plus
arm_3R 8126201..8126358 588..745 100 -> Plus
arm_3R 8119730..8120281 36..587 100 -> Plus
arm_3R 8116062..8116080 17..35 100 -> Plus

BO01046.pep Sequence

Translation from 16 to 877

> BO01046.pep
MGMRREAVQRGRVPPTQPGLAGMHGQYQIANGDPMGIAGFNGHSYLSSYI
SLLLRAEPYPTSRYGQCMQPNNIMGIDNICELAARLLFSAVEWAKNIPFF
PELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAAD
RVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTH
IESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFF
VRLVGKTPIETLIRDMLLSGNSFSWPYLPSMASFLDH

BO01046.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:39
Subject Length Description Subject Range Query Range Score Percent Strand
svp-PC 281 CG11502-PC 1..281 1..281 1458 100 Plus
svp-PB 543 CG11502-PB 263..543 1..281 1458 100 Plus
svp-PE 554 CG11502-PE 263..543 1..281 1458 100 Plus
svp-PA 746 CG11502-PA 263..452 1..190 986 100 Plus
dsf-PB 691 CG9019-PB 449..681 41..266 381 37.2 Plus