Clone BO01047 Report

Search the DGRC for BO01047

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG17118-RA
Protein status:BO01047.pep:
Sequenced Size:877

Clone Sequence Records

BO01047.3prime Sequence

876 bp (827 high quality bases) assembled on 2005-11-30

> BO01047.3prime
ATGGTCTAGAAAGCTTGCATAGTAGGCCTCTTCGGTGGCCTCCGTTTGTG
GAGCTGGCTCCTCGGTGGCCGGCTCTGGAGGAGCGGAAGCTGCTGGCGAC
GGAACCTTCTGCGGAACAGGCGGCGACGGAGACTTCTGCAGCGCAGGCTC
CGGCTCACTCATCGGATCCGTGGCGGGACCTGTTGCCTCTGCGTCCGTGT
CTTTGGAGGGTCCGGGTTCACCGCGACCCGTGTTCAAAGGCGACGGAGGA
CGCGCAGTGGCCTGCACCTTGAACTGCTTCTCCGGCTTCTTCAGATCCTT
CGGCTTGCCCATCAGACGGTAGTCATTGGGCAATTCAGCCTCTGTGTATA
GCTTATCGGCGAAGTAGATGCGCCGGATGCGTACGTTGGCATGCAGCTGC
AAGGATACCGTCTCCAGATAGTTGGAGCCGTAAGCACGGCGCGTGAAGTC
GGCCAGGTTAAACTGGATCTGGTTCCAGCCCGGTGACATGCCCATCGGCA
TCGCCGTGCAGAAGGGCTTCACGGAGGTCTTGCTCTGGAAATTGGACACT
CGGAAACGGCGCATGAAGCGCTGATCGTCTTGAATCTTAACTTCGAAGCA
AAAGTACTTGTGCATGTTCTTTATAAGGAGCACCAGGAAGGGCAACTTGA
TGCCCAGCTGCTCCTTGCATTCGCTGGGGCAGTGTATGAATGTGGTGGAC
ACATTTGAGCCCATTATCTCGAGCACCAGGGACTTGATGTCCTCATCGTA
GATCCGTTTGATATACCCGTTTTTGGTATAGGAAGACCAGTTGTTCAGGG
GCGAACTGCCTACGCTGTAAAGCACGGTAAGGGAAACCTTTTTGATAGGC
TGCACGATACATGTCGACTGATAACT

BO01047.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG17118-PA 846 CG17118-RA 30..843 832..19 3995 99.6 Minus
CG17118-PA 846 CG17118-RA 1..31 862..832 155 100 Minus
CG5343-PA 600 CG5343-RA 385..422 477..440 140 94.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17118-RA 979 CG17118-RA 45..887 862..19 4150 99.5 Minus
Bug22-RA 943 CG5343-RA 585..656 481..410 225 87.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10730696..10731264 587..19 2800 99.5 Minus
2L 23513712 2L 10730440..10730631 777..586 960 100 Minus
2L 23513712 2L 10730299..10730382 862..778 375 98.8 Minus
2L 23513712 2L 10430207..10430278 410..481 225 87.5 Plus
Blast to na_te.dros performed on 2015-02-10 15:13:11 has no hits.

BO01047.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:53 Download gff for BO01047.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17118-PA 1..846 15..862 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:21 Download gff for BO01047.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17118-PA 1..846 15..862 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:32:47 Download gff for BO01047.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 32..893 11..873 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:13:21 Download gff for BO01047.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 32..893 11..873 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:13:21 Download gff for BO01047.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 10730698..10731270 11..585 98   Minus
2L 10730440..10730631 586..777 100 -> Minus
2L 10730286..10730382 778..873 94 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:32:47 Download gff for BO01047.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10730698..10731270 11..585 98   Minus
arm_2L 10730440..10730631 586..777 100 -> Minus
arm_2L 10730286..10730382 778..873 94 -> Minus

BO01047.5prime Sequence

824 bp (686 high quality bases) assembled on 2005-11-30

> BO01047.5prime
GAAGTTATCAGTCGACATGTATCGTGCAGCCTATCAAAAAGGTTTCCTTA
CCGTGCTTTACAGCGTAGGCAGTTCGCCCCTGAACAACTGGTCTTCCTAT
ACCAAAAACGGGTATATCAAACGGATCTACGATGAGGACATCAAGTCCCT
GGTGCTCGAGATAATGGGCTCAAATGTGTCCACCACATTCATACACTGCC
CCAGCGAATGCAAGGAGCAGCTGGGCATCAAGTTGCCCTTCCTGGTGCTC
CTTATAAAGAACATGCACAAGTACTTTTGCTTCGAAGTTAAGATTCAAGA
CGATCAGCGCTTCATGCGCCGTTTCCGAGTGTCCAATTTCCAGAGCAAGA
CCTCCGTGAAGCCCTTCTGCACGGCGATGCCGATGGGCATGTCACCGGGC
TGGAACCAGATCCAGTTTAACCTGGCCGACTTCACGCGCCGTGCTTACGG
CTCCAACTATCTGGAGACGGTATCCTTGCAGCTGCATGCCAACGTACGCA
TCCGGCGCATCTACTTCGCCGATAAGCTATACACAGAGGCTGAATTGCCC
AATGACTACCGTCTGATGGGCAAGCCGAAGGATCTGAAGAAGCCGGAGAA
GCAGTTCAAGGTGCAGGCCACTGCGCGTCCTCCGTCGCCTTTGAACACGG
GTCGCGGTGAACCCGGACCCTCCAAAGACACGGACGCAGAGGCAACAGGT
CCCGCCACGGATCCGATGAGTGAGCCGGAGCCTGCGCTGCAGAAGTCTCC
GTCGCCGCCTGTTCCGCAGAAGGTTCCGTCGCCAGCAGCTTCCGCTCCTC
CAGAGCCGGCCACCGAGGAGCCAG

BO01047.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG17118-PA 846 CG17118-RA 1..808 17..824 3965 99.6 Plus
CG5343-PA 600 CG5343-RA 385..422 401..438 140 94.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17118-RA 979 CG17118-RA 45..852 17..824 3995 99.6 Plus
Bug22-RA 943 CG5343-RA 585..656 397..468 225 87.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10730696..10731229 291..824 2625 99.4 Plus
2L 23513712 2L 10730440..10730631 101..292 960 100 Plus
2L 23513712 2L 10730299..10730382 17..100 420 100 Plus
2L 23513712 2L 10430207..10430278 468..397 225 87.5 Minus
Blast to na_te.dros performed on 2015-02-11 23:44:19 has no hits.

BO01047.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:21:54 Download gff for BO01047.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17118-PA 1..808 17..824 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:23 Download gff for BO01047.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17118-PA 1..808 17..824 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:30:50 Download gff for BO01047.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 32..852 6..824 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:00:22 Download gff for BO01047.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 32..852 6..824 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:00:22 Download gff for BO01047.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 10730698..10731229 293..824 99   Plus
2L 10730440..10730631 101..292 100 -> Plus
2L 10730286..10730382 6..100 95 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:30:50 Download gff for BO01047.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10730698..10731229 293..824 99   Plus
arm_2L 10730440..10730631 101..292 100 -> Plus
arm_2L 10730286..10730382 6..100 95 -> Plus

BO01047.complete Sequence

877 bp (877 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629402

> BO01047.complete
GAAGTTATCAGTCGACATGTATCGTGCAGCCTATCAAAAAGGTTTCCTTA
CCGTGCTTTACAGCGTAGGCAGTTCGCCCCTGAACAACTGGTCTTCCTAT
ACCAAAAACGGGTATATCAAACGGATCTACGATGAGGACATCAAGTCCCT
GGTGCTCGAGATAATGGGCTCAAATGTGTCCACCACATTCATACACTGCC
CCAGCGAATGCAAGGAGCAGCTGGGCATCAAGTTGCCCTTCCTGGTGCTC
CTTATAAAGAACATGCACAAGTACTTTTGCTTCGAAGTTAAGATTCAAGA
CGATCAGCGCTTCATGCGCCGTTTCCGAGTGTCCAATTTCCAGAGCAAGA
CCTCCGTGAAGCCCTTCTGCACGGCGATGCCGATGGGCATGTCACCGGGC
TGGAACCAGATCCAGTTTAACCTGGCCGACTTCACGCGCCGTGCTTACGG
CTCCAACTATCTGGAGACGGTATCCTTGCAGCTGCATGCCAACGTACGCA
TCCGGCGCATCTACTTCGCCGATAAGCTATACACAGAGGCTGAATTGCCC
AATGACTACCGTCTGATGGGCAAGCCGAAGGATCTGAAGAAGCCGGAGAA
GCAGTTCAAGGTGCAGGCCACTGCGCGTCCTCCGTCGCCTTTGAACACGG
GTCGCGGTGAACCCGGACCCTCCAAAGACACGGACGCAGAGGCAACAGGT
CCCGCCACGGATCCGATGAGTGAGCCGGAGCCTGCGCTGCAGAAGTCTCC
GTCGCCGCCTGTTCCGCAGAAGGTTCCGTCGCCAGCAGCTTCCGCTCCTC
CAGAGCCGGCCACCGAGGAGCCAGCTCCACAAACGGAGGCCACCGAAGAG
GCCTACTATGCAAGCTTTCTAGACCAT

BO01047.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG17118-RA 846 CG17118-PA 1..843 17..859 4170 99.6 Plus
Bug22-RA 600 CG5343-PA 381..452 397..468 225 87.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG17118-RA 979 CG17118-RA 45..887 17..859 4170 99.6 Plus
Bug22-RA 943 CG5343-RA 585..656 397..468 225 87.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10730696..10731264 291..859 2800 99.5 Plus
2L 23513712 2L 10730440..10730631 101..292 960 100 Plus
2L 23513712 2L 10730299..10730382 17..100 420 100 Plus
2L 23513712 2L 10430207..10430278 468..397 225 87.5 Minus
Blast to na_te.dros performed on 2014-11-27 13:53:21 has no hits.

BO01047.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:34 Download gff for BO01047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 1..846 17..863 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:36 Download gff for BO01047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 32..893 6..867 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:44 Download gff for BO01047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 45..887 17..861 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:34 Download gff for BO01047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 32..893 6..867 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:58:15 Download gff for BO01047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 45..887 17..861 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:58:15 Download gff for BO01047.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10730698..10731264 293..861 99   Plus
2L 10730440..10730631 101..292 100 -> Plus
2L 10730299..10730382 17..100 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:44 Download gff for BO01047.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10730698..10731264 293..861 99   Plus
arm_2L 10730440..10730631 101..292 100 -> Plus
arm_2L 10730299..10730382 17..100 100 -> Plus

BO01047.pep Sequence

Translation from 16 to 877

> BO01047.pep
MYRAAYQKGFLTVLYSVGSSPLNNWSSYTKNGYIKRIYDEDIKSLVLEIM
GSNVSTTFIHCPSECKEQLGIKLPFLVLLIKNMHKYFCFEVKIQDDQRFM
RRFRVSNFQSKTSVKPFCTAMPMGMSPGWNQIQFNLADFTRRAYGSNYLE
TVSLQLHANVRIRRIYFADKLYTEAELPNDYRLMGKPKDLKKPEKQFKVQ
ATARPPSPLNTGRGEPGPSKDTDAEATGPATDPMSEPEPALQKSPSPPVP
QKVPSPAASAPPEPATEEPAPQTEATEEAYYASFLDH

BO01047.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG17118-PA 281 CG17118-PA 1..281 1..281 1490 100 Plus
Bug22-PA 199 CG5343-PA 1..183 1..183 642 62.8 Plus