Clone BO01054 Report

Search the DGRC for BO01054

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptCG8314-RA
Protein status:BO01054.pep:
Sequenced Size:913

Clone Sequence Records

BO01054.3prime Sequence

815 bp (806 high quality bases) assembled on 2005-11-30

> BO01054.3prime
ATGGTCTAGAAAGCTTGCGACTGAATAGAAGTGCGAGTTGAATCTTGTGC
GGCACGAGGGCTCCGTGAATGGTGAAAACCAGGCCAACGAGAAGCGTCCG
AACACCGACTGGATGCTCTTGAGGCGCGATTTCTTCGCCCAGCGGGCCTC
CTCCTTCTTCAGCTGTTCGATGCCCGTCTGATCGTTTAGGATAGCCGTCA
GCTGAGTGGCCAGCATGATGATGGTGAATATGCCGAACATAAGGCCCTCA
AAGGTGAGAAAAAGCAGCAGGAATATAGTGGCCGGCGGAGAGTACGGCGA
GCAGGTGCGCCAGTCGTTTTTCACGCACTCCGCGAACTGGGTGAGCACCA
GGAAGAGCGTGTGCACGGAGATCGAAGCGATATAGAAGGTGAAGAGCACA
AAGTACTTTTGATTGTTCTCGCCCACGCAATTATTTACCCACGGACAGTG
GTGATCCATCTTGCGGATGCAGCGCTGGCAGACGGAACAGTGATGAGCTC
GTTCCGGCTTGATACTGCAGCACTTGGGGCACTTGTAGAACATCTGACCC
TCGCGGTAGCCCATCTGCTCGATCATCTCCTTGGTGGCATTTCCGCGCGG
TACAGCGCCCGGATCCGAGAGCATTGTGCGTATGTGCGAGGCGAAGGCCA
GGAAGGCGAGTGCCTGGAATATGATCATGTTGATGGTACTGAAGACGGTA
TAGTTGCTGGGCAGAAGGATCAGCCGCATGACCACGAATTCGGCGAACAG
GATAAGCAGCCAGGTCATGATTACGCACACAATGCCGCAGATGTCCTTGA
CGCACCAGGCCCTTG

BO01054.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-PA 882 CG8314-RA 87..879 811..19 3965 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-RA 1280 CG8314-RA 227..1019 811..19 3965 100 Minus
CG5880-RA 1526 CG5880-RA 587..662 497..422 200 84.2 Minus
Dnz1-RA 1949 CG6627-RA 705..806 502..401 180 78.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15990452..15990674 388..610 1115 100 Plus
2R 25286936 2R 15990169..15990382 174..387 1070 100 Plus
2R 25286936 2R 15990858..15991060 609..811 1015 100 Plus
2R 25286936 2R 15989944..15990100 19..175 785 100 Plus
Blast to na_te.dros performed on 2015-02-12 00:41:59 has no hits.

BO01054.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:04 Download gff for BO01054.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8314-PA 84..882 16..815 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:41 Download gff for BO01054.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8314-PA 84..882 16..815 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:31:48 Download gff for BO01054.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 224..1019 19..815 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:11:31 Download gff for BO01054.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 224..1019 19..815 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:11:31 Download gff for BO01054.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 15990859..15991063 610..815 99   Plus
2R 15990452..15990673 388..609 100 <- Plus
2R 15990170..15990382 175..387 100 <- Plus
2R 15989944..15990099 19..174 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:31:48 Download gff for BO01054.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11878364..11878568 610..815 99   Plus
arm_2R 11877957..11878178 388..609 100 <- Plus
arm_2R 11877675..11877887 175..387 100 <- Plus
arm_2R 11877449..11877604 19..174 100 <- Plus

BO01054.5prime Sequence

858 bp (824 high quality bases) assembled on 2005-11-30

> BO01054.5prime
GAAGTTATCAGTCGACATGAACTACTCGTACTCCGCGCTGTCGCCCGGCG
GTAGCGGAGGATTCGGTGGCGTTGACCAGCACAACCGATGTTGCGGAAAC
AAGGCCTGGTGCGTCAAGGACATCTGCGGCATTGTGTGCGTAATCATGAC
CTGGCTGCTTATCCTGTTCGCCGAATTCGTGGTCATGCGGCTGATCCTTC
TGCCCAGCAACTATACCGTCTTCAGTACCATCAACATGATCATATTCCAG
GCACTCGCCTTCCTGGCCTTCGCCTCGCACATACGCACAATGCTCTCGGA
TCCGGGCGCTGTACCGCGCGGAAATGCCACCAAGGAGATGATCGAGCAGA
TGGGCTACCGCGAGGGTCAGATGTTCTACAAGTGCCCCAAGTGCTGCAGT
ATCAAGCCGGAACGAGCTCATCACTGTTCCGTCTGCCAGCGCTGCATCCG
CAAGATGGATCACCACTGTCCGTGGGTAAATAATTGCGTGGGCGAGAACA
ATCAAAAGTACTTTGTGCTCTTCACCTTCTATATCGCTTCGATCTCCGTG
CACACGCTCTTCCTGGTGCTCACCCAGTTCGCGGAGTGCGTGAAAAACGA
CTGGCGCACCTGCTCGCCGTACTCTCCGCCGGCCACTATATTCCTGCTGC
TTTTTCTCACCTTTGAGGGCCTTATGTTCGGCATATTCACCATCATCATG
CTGGCCACTCAGCTGACGGCTATCCTAAACGATCAGACGGGCATCGAACA
GCTGAAGAAGGAGGAGGCCCGCTGGGCGAAGAAATCGCGCCCTCAGAGCA
TCCAGTCGGTGTTCGGACGCTTCTCGTTGGCCTGGTTTTCACCATTCACG
GAGCCCTC

BO01054.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-PA 882 CG8314-RA 1..775 17..791 3875 100 Plus
CG8314-PA 882 CG8314-RA 779..842 795..858 320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-RA 1280 CG8314-RA 140..982 16..858 4170 99.8 Plus
CG5880-RA 1526 CG5880-RA 587..662 417..492 200 84.2 Plus
Dnz1-RA 1949 CG6627-RA 705..806 412..513 180 78.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15990858..15991147 305..16 1450 100 Minus
2R 25286936 2R 15990452..15990674 526..304 1115 100 Minus
2R 25286936 2R 15990169..15990382 740..527 1070 100 Minus
2R 25286936 2R 15989981..15990100 858..739 555 97.5 Minus
Blast to na_te.dros performed on 2015-02-12 10:09:05 has no hits.

BO01054.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:05 Download gff for BO01054.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8314-PA 1..842 17..858 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:43 Download gff for BO01054.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8314-PA 1..842 17..858 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:47:09 Download gff for BO01054.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 140..982 16..858 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:08:33 Download gff for BO01054.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 140..982 16..858 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:08:33 Download gff for BO01054.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 15990859..15991147 16..304 100   Minus
2R 15990452..15990673 305..526 100 <- Minus
2R 15990170..15990382 527..739 100 <- Minus
2R 15989981..15990099 740..858 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:47:09 Download gff for BO01054.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11878364..11878652 16..304 100   Minus
arm_2R 11877957..11878178 305..526 100 <- Minus
arm_2R 11877675..11877887 527..739 100 <- Minus
arm_2R 11877486..11877604 740..858 98 <- Minus

BO01054.complete Sequence

913 bp (913 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629405

> BO01054.complete
GAAGTTATCAGTCGACATGAACTACTCGTACTCCGCGCTGTCGCCCGGCG
GTAGCGGAGGATTCGGTGGCGTTGACCAGCACAACCGATGTTGCGGAAAC
AAGGCCTGGTGCGTCAAGGACATCTGCGGCATTGTGTGCGTAATCATGAC
CTGGCTGCTTATCCTGTTCGCCGAATTCGTGGTCATGCGGCTGATCCTTC
TGCCCAGCAACTATACCGTCTTCAGTACCATCAACATGATCATATTCCAG
GCACTCGCCTTCCTGGCCTTCGCCTCGCACATACGCACAATGCTCTCGGA
TCCGGGCGCTGTACCGCGCGGAAATGCCACCAAGGAGATGATCGAGCAGA
TGGGCTACCGCGAGGGTCAGATGTTCTACAAGTGCCCCAAGTGCTGCAGT
ATCAAGCCGGAACGAGCTCATCACTGTTCCGTCTGCCAGCGCTGCATCCG
CAAGATGGATCACCACTGTCCGTGGGTAAATAATTGCGTGGGCGAGAACA
ATCAAAAGTACTTTGTGCTCTTCACCTTCTATATCGCTTCGATCTCCGTG
CACACGCTCTTCCTGGTGCTCACCCAGTTCGCGGAGTGCGTGAAAAACGA
CTGGCGCACCTGCTCGCCGTACTCTCCGCCGGCCACTATATTCCTGCTGC
TTTTTCTCACCTTTGAGGGCCTTATGTTCGGCATATTCACCATCATCATG
CTGGCCACTCAGCTGACGGCTATCCTAAACGATCAGACGGGCATCGAACA
GCTGAAGAAGGAGGAGGCCCGCTGGGCGAAGAAATCGCGCCTCAAGAGCA
TCCAGTCGGTGTTCGGACGCTTCTCGTTGGCCTGGTTTTCACCATTCACG
GAGCCCTCGTGCCGCACAAGATTCAACTCGCACTTCTATTCAGTCGCAAG
CTTTCTAGACCAT

BO01054.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-RA 882 CG8314-PA 1..879 17..895 4395 100 Plus
CG5880-RA 1146 CG5880-PA 449..524 417..492 200 84.2 Plus
Dnz1-RA 831 CG6627-PA 339..440 412..513 180 78.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-RA 1280 CG8314-RA 140..1019 16..895 4400 100 Plus
CG5880-RA 1526 CG5880-RA 587..662 417..492 200 84.2 Plus
Dnz1-RA 1949 CG6627-RA 705..806 412..513 180 78.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15990858..15991147 305..16 1450 100 Minus
2R 25286936 2R 15990452..15990674 526..304 1115 100 Minus
2R 25286936 2R 15990169..15990382 740..527 1070 100 Minus
2R 25286936 2R 15989944..15990100 895..739 785 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:18:02 has no hits.

BO01054.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:38 Download gff for BO01054.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 1..882 17..898 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:41 Download gff for BO01054.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 136..1015 16..895 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:53:30 Download gff for BO01054.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 141..1019 17..897 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:38 Download gff for BO01054.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 136..1015 16..895 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:56:59 Download gff for BO01054.complete
Subject Subject Range Query Range Percent Splice Strand
CG8314-RA 141..1019 17..897 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:56:59 Download gff for BO01054.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15990859..15991146 17..304 100   Minus
2R 15990452..15990673 305..526 100 <- Minus
2R 15990170..15990382 527..739 100 <- Minus
2R 15989941..15990099 740..897 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:53:30 Download gff for BO01054.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11878364..11878651 17..304 100   Minus
arm_2R 11877957..11878178 305..526 100 <- Minus
arm_2R 11877675..11877887 527..739 100 <- Minus
arm_2R 11877446..11877604 740..897 98 <- Minus

BO01054.pep Sequence

Translation from 16 to 913

> BO01054.pep
MNYSYSALSPGGSGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLIL
FAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVP
RGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHH
CPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCS
PYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEE
ARWAKKSRLKSIQSVFGRFSLAWFSPFTEPSCRTRFNSHFYSVASFLDH

BO01054.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG8314-PA 293 CG8314-PA 1..293 1..293 1588 100 Plus
Dnz1-PA 276 CG6627-PA 4..267 33..287 424 32.2 Plus
CG1407-PF 449 CG1407-PF 10..295 34..276 269 27.6 Plus
CG1407-PG 452 CG1407-PG 10..298 34..276 269 27.2 Plus
CG1407-PE 440 CG1407-PE 10..286 34..276 266 27.2 Plus