Clone BO01056 Report

Search the DGRC for BO01056

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptAntp-RH
Protein status:BO01056.pep:
Sequenced Size:925

Clone Sequence Records

BO01056.3prime Sequence

871 bp (798 high quality bases) assembled on 2005-11-30

> BO01056.3prime
ATGGTCTAGAAAGCTTGCCTTTCCTTGACACTTACCAAACTGACTTCGCA
TCCAGGGATACAGTGGAGACGGCATCCCCGAGGACTGCGAGTTCGGGTTT
TGGGAAGGAGGCGTGTGTTGGCCAGGATGTCCCTGGTGCATCTGTGGAGG
ACCCTGGCCCTGGTGCATCATGCCCTGAGGTGGGGCACCCACCGGCGGAA
CTCCCGACTGCTGCTGGTACATGCCCATGTTGTGATGGTTCTGATGGACC
TCTGTCACGTCGGGAACTCCAACGTCCGTATAGCCCAACTGCGCCTGCGG
ATGTCCCATGTGATGGGGCAGCGTCATCTGGGCGTTCATGTGGTGACCGG
ACATTTGATCCACCAGCGGAGGCGATCCGCCCTCGGGAACCATACCCAGT
CCACCAACGGCCGCTTGCAACTTGCAGCTGGCGTAGACGACGGGCTGCTG
TTGTTGCTGCTGCGGATGTGTCACCTGTTGCGTCACCTGCGGCAGCTGCT
GCTGCAGTTGCTGTGGGGCCTGCTGCGCCTGCTGTTGCTGCTGGTTCTGC
GAGGGCTGTTGCTGCTGCTGCTGTTGCTGCTGGGGAACACCCAACTGACC
GTTGGTCTGCGCCTGGGGCATGACCCCGCCCACCTGGCTGGAGGGGCTGT
CCGGGCGGGAGTAGACCTGGTGCTGCTGCTGCTGGTCCATCCCCTGGCCG
TTGTAGTAGGGCATGCGGTCGTAGGGTGGAAAGCGCGGGTAGGGCATGTT
GCCCTGGTGATTCGCGTTCTGGCTGTAGTGGTGCATCTGCTGGGCGTCCA
GGTCGGTGACCCCGTTGCCCGGGTAGTGCCCATGATGCATGTCCGCCCCC
ATGTACGAGTTGGTGAAGTAC

BO01056.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG1028-PH 894 Antp-RH 39..891 871..19 4265 100 Minus
CG1028-PL 1137 Antp-RL 39..886 871..24 4240 100 Minus
CG1028-PI 1137 Antp-RI 39..886 871..24 4240 100 Minus
CG1028-PJ 1137 Antp-RJ 39..886 871..24 4240 100 Minus
CG1028-PM 1137 Antp-RM 39..886 871..24 4240 100 Minus
CG1028-PD 1125 Antp-RD 39..874 871..36 4180 100 Minus
CG1028-PN 1125 Antp-RN 39..874 871..36 4180 100 Minus
CG1028-PF 1098 Antp-RF 39..621 871..289 2915 100 Minus
CG1028-PE 1098 Antp-RE 39..621 871..289 2915 100 Minus
CG1028-PK 1086 Antp-RK 39..621 871..289 2915 100 Minus
CG1028-PG 1086 Antp-RG 39..621 871..289 2915 100 Minus
CG1028-PF 1098 Antp-RF 620..847 251..24 1140 100 Minus
CG1028-PE 1098 Antp-RE 620..847 251..24 1140 100 Minus
CG1028-PK 1086 Antp-RK 620..835 251..36 1080 100 Minus
CG1028-PG 1086 Antp-RG 620..835 251..36 1080 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-RH 4111 CG1028-RH 1769..2621 871..19 4265 100 Minus
Antp-RJ 3490 CG1028-RJ 1769..2616 871..24 4240 100 Minus
Antp-RI 3279 CG1028-RI 1558..2405 871..24 4240 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6909290..6909872 289..871 2915 100 Plus
3R 32079331 3R 6908508..6908740 19..251 1165 100 Plus
3R 32079331 3R 6908871..6908915 248..292 225 100 Plus
Blast to na_te.dros performed 2015-02-12 10:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6851 583..444 337 75 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6764..6900 582..446 316 72.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6800..6923 582..447 275 71.3 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2343..2497 582..423 266 65 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2397..2536 582..443 259 65 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6728..7004 706..444 251 60.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2415 549..444 242 69.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6859 560..422 238 64.3 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2406 543..444 203 67 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2726..2890 585..420 196 60.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2517..2655 582..444 191 61.7 Minus
roo 9092 roo DM_ROO 9092bp 1059..1154 545..447 191 67.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2403 538..444 186 67.3 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6803 545..444 174 70.6 Minus
roo 9092 roo DM_ROO 9092bp 1060..1133 517..444 163 68.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2496..2826 792..444 162 55.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6661..6804 562..423 161 59 Minus
TART-C 11124 TART-C TARTC 11124bp 8755..8922 584..421 154 58 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2383..2657 686..422 145 55.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2376 513..444 134 65.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1470..1578 549..444 123 60.9 Minus
gypsy11 4428 gypsy11 GYPSY11 4428bp 891..1011 569..444 120 60.3 Minus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3192..3346 569..409 115 56.2 Minus

BO01056.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:06 Download gff for BO01056.3prime
Subject Subject Range Query Range Percent Splice Strand
Antp-PH 39..894 16..871 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:44 Download gff for BO01056.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1028-PH 39..894 16..871 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:47:11 Download gff for BO01056.3prime
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1769..2621 19..871 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:08:56 Download gff for BO01056.3prime
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1769..2621 19..871 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:08:56 Download gff for BO01056.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 6909290..6909872 289..871 100   Plus
3R 6908873..6908911 250..288 100 <- Plus
3R 6908508..6908738 19..249 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:47:11 Download gff for BO01056.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2735012..2735594 289..871 100   Plus
arm_3R 2734595..2734633 250..288 100 <- Plus
arm_3R 2734230..2734460 19..249 100 <- Plus

BO01056.5prime Sequence

870 bp (813 high quality bases) assembled on 2005-11-30

> BO01056.5prime
GAAGTTATCAGTCGACATGACGATGAGTACAAACAACTGCGAGAGCATGA
CCTCGTACTTCACCAACTCGTACATGGGGGCGGACATGCATCATGGGCAC
TACCCGGGCAACGGGGTCACCGACCTGGACGCCCAGCAGATGCACCACTA
CAGCCAGAACGCGAATCACCAGGGCAACATGCCCTACCCGCGCTTTCCAC
CCTACGACCGCATGCCCTACTACAACGGCCAGGGGATGGACCAGCAGCAG
CAGCACCAGGTCTACTCCCGCCCGGACAGCCCCTCCAGCCAGGTGGGCGG
GGTCATGCCCCAGGCGCAGACCAACGGTCAGTTGGGTGTTCCCCAGCAGC
AACAGCAGCAGCAGCAACAGCCCTCGCAGAACCAGCAGCAACAGCAGGCG
CAGCAGGCCCCACAGCAACTGCAGCAGCAGCTGCCGCAGGTGACGCAACA
GGTGACACATCCGCAGCAGCAACAACAGCAGCCCGTCGTCTACGCCAGCT
GCAAGTTGCAAGCGGCCGTTGGTGGACTGGGTATGGTTCCCGAGGGCGGA
TCGCCTCCGCTGGTGGATCAAATGTCCGGTCACCACATGAACGCCCAGAT
GACGCTGCCCCATCACATGGGACATCCGCAGGCGCAGTTGGGCTATACGG
ACGTTGGAGTTCCCGACGTGACAGAGGTCCATCAGAACCATCACAACATG
GGCATGTACCAGCAGCAGTCGGGAGTTCCGCCGGTGGGTGCCCCACCTCA
NGGCATGATGCACCAGGGCCAGGGTCCTCCACAGATGCACCAGGGACATC
CTGGCCAACACACGCCTCCTTCCCAAAAACCCGACTCGCAGTCCTCGGGG
ATGCCGTCTCCACTGTATCC

BO01056.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG1028-PL 1137 Antp-RL 1..854 17..870 4176 99.5 Plus
CG1028-PI 1137 Antp-RI 1..854 17..870 4176 99.5 Plus
CG1028-PJ 1137 Antp-RJ 1..854 17..870 4176 99.5 Plus
CG1028-PH 894 Antp-RH 1..854 17..870 4176 99.5 Plus
CG1028-PM 1137 Antp-RM 1..854 17..870 4176 99.5 Plus
CG1028-PD 1125 Antp-RD 1..854 17..870 4176 99.5 Plus
CG1028-PN 1125 Antp-RN 1..854 17..870 4176 99.5 Plus
CG1028-PF 1098 Antp-RF 1..621 17..637 3105 100 Plus
CG1028-PK 1086 Antp-RK 1..621 17..637 3105 100 Plus
CG1028-PG 1086 Antp-RG 1..621 17..637 3105 100 Plus
CG1028-PE 1098 Antp-RE 1..621 17..637 3105 100 Plus
CG1028-PF 1098 Antp-RF 620..815 675..870 886 97.9 Plus
CG1028-PK 1086 Antp-RK 620..815 675..870 886 97.9 Plus
CG1028-PG 1086 Antp-RG 620..815 675..870 886 97.9 Plus
CG1028-PE 1098 Antp-RE 620..815 675..870 886 97.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-RJ 3490 CG1028-RJ 1731..2584 17..870 4214 99.6 Plus
Antp-RI 3279 CG1028-RI 1520..2373 17..870 4214 99.6 Plus
Antp-RL 4902 CG1028-RL 1731..2584 17..870 4214 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6909290..6909910 637..17 3105 100 Minus
3R 32079331 3R 6908545..6908740 870..675 924 98 Minus
3R 32079331 3R 6908871..6908915 678..634 225 100 Minus
Blast to na_te.dros performed 2015-02-13 00:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6851 343..482 337 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6764..6900 344..480 316 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6800..6923 344..479 275 71.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2343..2497 344..503 266 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2397..2536 344..483 259 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6728..7004 220..482 251 60.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2415 377..482 242 69.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6859 366..504 238 64.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2406 383..482 203 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2726..2890 341..506 196 60.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2517..2655 344..482 191 61.7 Plus
roo 9092 roo DM_ROO 9092bp 1059..1154 381..479 191 67.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2403 388..482 186 67.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6803 381..482 174 70.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2389..2826 26..482 168 54.5 Plus
roo 9092 roo DM_ROO 9092bp 1060..1133 409..482 163 68.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6661..6804 364..503 161 59 Plus
TART-C 11124 TART-C TARTC 11124bp 8755..8922 342..505 154 58 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2383..2657 240..504 145 55.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2376 413..482 134 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1470..1578 377..482 123 60.9 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 891..1011 357..482 120 60.3 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3192..3346 357..517 115 56.2 Plus

BO01056.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:07 Download gff for BO01056.5prime
Subject Subject Range Query Range Percent Splice Strand
Antp-PN 1..854 17..870 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:46 Download gff for BO01056.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1028-PH 1..854 17..870 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:28:15 Download gff for BO01056.5prime
Subject Subject Range Query Range Percent Splice Strand
Antp-RL 1731..2584 17..870 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:58:33 Download gff for BO01056.5prime
Subject Subject Range Query Range Percent Splice Strand
Antp-RL 1731..2584 17..870 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:58:33 Download gff for BO01056.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 6909290..6909910 17..637 100   Minus
3R 6908873..6908911 638..676 100 <- Minus
3R 6908545..6908738 677..870 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:28:15 Download gff for BO01056.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2735012..2735632 17..637 100   Minus
arm_3R 2734595..2734633 638..676 100 <- Minus
arm_3R 2734267..2734460 677..870 98 <- Minus

BO01056.complete Sequence

925 bp (925 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629406

> BO01056.complete
GAAGTTATCAGTCGACATGACGATGAGTACAAACAACTGCGAGAGCATGA
CCTCGTACTTCACCAACTCGTACATGGGGGCGGACATGCATCATGGGCAC
TACCCGGGCAACGGGGTCACCGACCTGGACGCCCAGCAGATGCACCACTA
CAGCCAGAACGCGAATCACCAGGGCAACATGCCCTACCCGCGCTTTCCAC
CCTACGACCGCATGCCCTACTACAACGGCCAGGGGATGGACCAGCAGCAG
CAGCACCAGGTCTACTCCCGCCCGGACAGCCCCTCCAGCCAGGTGGGCGG
GGTCATGCCCCAGGCGCAGACCAACGGTCAGTTGGGTGTTCCCCAGCAGC
AACAGCAGCAGCAGCAACAGCCCTCGCAGAACCAGCAGCAACAGCAGGCG
CAGCAGGCCCCACAGCAACTGCAGCAGCAGCTGCCGCAGGTGACGCAACA
GGTGACACATCCGCAGCAGCAACAACAGCAGCCCGTCGTCTACGCCAGCT
GCAAGTTGCAAGCGGCCGTTGGTGGACTGGGTATGGTTCCCGAGGGCGGA
TCGCCTCCGCTGGTGGATCAAATGTCCGGTCACCACATGAACGCCCAGAT
GACGCTGCCCCATCACATGGGACATCCGCAGGCGCAGTTGGGCTATACGG
ACGTTGGAGTTCCCGACGTGACAGAGGTCCATCAGAACCATCACAACATG
GGCATGTACCAGCAGCAGTCGGGAGTTCCGCCGGTGGGTGCCCCACCTCA
GGGCATGATGCACCAGGGCCAGGGTCCTCCACAGATGCACCAGGGACATC
CTGGCCAACACACGCCTCCTTCCCAAAACCCGAACTCGCAGTCCTCGGGG
ATGCCGTCTCCACTGTATCCCTGGATGCGAAGTCAGTTTGGTAAGTGTCA
AGGAAAGGCAAGCTTTCTAGACCAT

BO01056.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-RH 894 CG1028-PH 1..891 17..907 4455 100 Plus
Antp-RJ 1137 CG1028-PJ 1..886 17..902 4430 100 Plus
Antp-RI 1137 CG1028-PI 1..886 17..902 4430 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-RH 4111 CG1028-RH 1731..2621 17..907 4455 100 Plus
Antp-RJ 3490 CG1028-RJ 1731..2616 17..902 4430 100 Plus
Antp-RI 3279 CG1028-RI 1520..2405 17..902 4430 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6909290..6909910 637..17 3105 100 Minus
3R 32079331 3R 6908508..6908740 907..675 1165 100 Minus
3R 32079331 3R 6908871..6908915 678..634 225 100 Minus
Blast to na_te.dros performed 2014-11-27 16:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6851 343..482 337 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6764..6900 344..480 316 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6800..6923 344..479 275 71.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2343..2497 344..503 266 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2397..2536 344..483 259 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6728..7004 220..482 251 60.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2415 377..482 242 69.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6859 366..504 238 64.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2406 383..482 203 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2726..2890 341..506 196 60.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2517..2655 344..482 191 61.7 Plus
roo 9092 roo DM_ROO 9092bp 1059..1154 381..479 191 67.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2403 388..482 186 67.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6803 381..482 174 70.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2389..2826 26..482 168 54.5 Plus
roo 9092 roo DM_ROO 9092bp 1060..1133 409..482 163 68.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6661..6804 364..503 161 59 Plus
TART-C 11124 TART-C TARTC 11124bp 8755..8922 342..505 154 58 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2383..2657 240..504 145 55.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2376 413..482 134 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1470..1578 377..482 123 60.9 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 891..1011 357..482 120 60.3 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3192..3346 357..517 115 56.2 Plus

BO01056.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:39 Download gff for BO01056.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1..894 17..910 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:42 Download gff for BO01056.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1731..2621 17..907 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:58:47 Download gff for BO01056.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1731..2621 17..909 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:39 Download gff for BO01056.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1731..2621 17..907 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:02 Download gff for BO01056.complete
Subject Subject Range Query Range Percent Splice Strand
Antp-RH 1731..2621 17..909 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:26:02 Download gff for BO01056.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6909290..6909910 17..637 100   Minus
3R 6908873..6908911 638..676 100 <- Minus
3R 6908505..6908738 677..909 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:58:47 Download gff for BO01056.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2735012..2735632 17..637 100   Minus
arm_3R 2734595..2734633 638..676 100 <- Minus
arm_3R 2734227..2734460 677..909 99 <- Minus

BO01056.pep Sequence

Translation from 16 to 925

> BO01056.pep
MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNAN
HQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQA
QTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQ
QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
MGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQ
GQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQGKASF
LDH

BO01056.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Antp-PH 297 CG1028-PH 1..297 1..297 1655 100 Plus
Antp-PJ 378 CG1028-PJ 1..295 1..295 1644 100 Plus
Antp-PI 378 CG1028-PI 1..295 1..295 1644 100 Plus
Antp-PL 378 CG1028-PL 1..295 1..295 1644 100 Plus
Antp-PM 378 CG1028-PM 1..295 1..295 1644 100 Plus