Clone BO01058 Report

Search the DGRC for BO01058

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptAef1-RA
Protein status:BO01058.pep: full length peptide match
Sequenced Size:958

Clone Sequence Records

BO01058.3prime Sequence

845 bp (828 high quality bases) assembled on 2005-11-30

> BO01058.3prime
ATGGTCTAGAAAGCTTGCCCCCTCATCCTCCTCTGTTTTGATCTTAACAG
GAACGTAGACTTTGTCCATGACGTGTATTTTTATGTGGTTGTTGAGCGTG
CTGGACTGTCGGAACTGCTTCTTGCAGATGACACACTCAAAAGGCTTTTC
ACCCGTGTGGATCTTCACATGGTTGGCCAGCGTGCTCAGTTGTCGAAAAT
GCTTGGGACAAAAGTTGCAGTTATAAGGCTTCTCGCCCGTATGGATCTTC
AGATGGTTCGTCAGCGTCGACGATTGACGGAAGGTCTTATCACAAACGTT
GCATTTGTAGGGCTTCTCGCCAGTATGGATCTTTACATGGTTGGTCAGTG
TGCTTAGCTGTCGAAAGCGACGATCGCAGACGGTGCAGTGGAAAGGTTTC
TCCGGCTCGCGGACAGCTCCCCCTACGCCAACGGCAGCGTTGCCCTCTCC
GGGATGCTCGCTATGTCCATTGGCCAGGTAATGCTCACTGTGGATCGTTG
TCGGACTATGCGTGGTCAGGTGCGTCAGATGTGAAGTTGGTGGCGGCGGT
TGCTGTTGTTCCGCCGCAGCAGCTTGGGCTGCTGCAGCTTGGGCAGCTGC
CATAGCCGCTGCTTGGGCGGCACTATGCGCCTCCGCCGAGATCCCGCTTA
AGTGCATCTGGAAGGGCAAGGGGAGTTCCGTGGGTGGCGGCGGCACAGAG
GGTGGTCCGCTCGACTGCTGTTGCTGCTGCTGATGATGTTGCTGCTGCTG
TTGCTGTTGTTGTTGCTGCTGCTGTTGAACCGCCGCCATGTGAGCCGGAT
GCGTGGCCTGGGTGACCGTCTCATTGTTATTATTGTTTGCTATGG

BO01058.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG5683-PA 927 Aef1-RA 98..924 845..19 4135 100 Minus
CG5683-PC 927 Aef1-RC 98..924 845..19 4135 100 Minus
CG5683-PB 927 Aef1-RB 98..924 845..19 4135 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-RD 2684 CG5683-RD 573..1399 845..19 4135 100 Minus
Aef1-RB 2579 CG5683-RB 468..1294 845..19 4135 100 Minus
Aef1-RC 2622 CG5683-RC 511..1337 845..19 4135 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21435317..21436013 845..149 3485 100 Minus
3L 28110227 3L 21436072..21436206 153..19 675 100 Minus
3L 28110227 3L 21435814..21435937 264..141 215 78.2 Minus
3L 28110227 3L 21435898..21436014 348..232 195 77.8 Minus
Blast to na_te.dros performed on 2015-02-11 04:15:56 has no hits.

BO01058.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:10 Download gff for BO01058.3prime
Subject Subject Range Query Range Percent Splice Strand
Aef1-PB 98..927 16..845 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:50 Download gff for BO01058.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5683-PB 98..927 16..845 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 05:00:17 Download gff for BO01058.3prime
Subject Subject Range Query Range Percent Splice Strand
Aef1-RC 511..1337 19..845 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:05:32 Download gff for BO01058.3prime
Subject Subject Range Query Range Percent Splice Strand
Aef1-RC 511..1337 19..845 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:05:32 Download gff for BO01058.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 21436073..21436206 19..152 100   Minus
3L 21435317..21436009 153..845 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 05:00:17 Download gff for BO01058.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21429173..21429306 19..152 100   Minus
arm_3L 21428417..21429109 153..845 100 -> Minus

BO01058.5prime Sequence

844 bp (762 high quality bases) assembled on 2005-11-30

> BO01058.5prime
GAAGTTATCAGTCGACATGATGCATATCAAAAGCCTGCCCCATGCCCATG
CCGCTGCTACGGCGATGAGCAGTAACTGCGACATTGTCATAGTGGCCGCC
CAGCCCCAAACCACCATAGCAAACAATAATAACAATGAGACGGTCACCCA
GGCCACGCATCCGGCTCACATGGCGGCGGTTCAACAGCAGCAGCAACAAC
AACAGCAACAGCAGCAGCAACATCATCAGCAGCAGCAACAGCAGTCGAGC
GGACCACCCTCTGTGCCGCCGCCACCCACGGAACTCCCCTTGCCCTTCCA
GATGCACTTAAGCGGGATCTCGGCGGAGGCGCATAGTGCCGCCCAAGCAG
CGGCTATGGCAGCTGCCCAAGCTGCAGCAGCCCAAGCTGCTGCGGCGGAA
CAACAGCAACCGCCGCCACCAACTTCACATCTGACGCACCTGACCACGCA
TAGTCCGACAACGATCCACAGTGAGCATTACCTGGCCAATGGACATAGCG
AGCATCCCGGAGAGGGCAACGCTGCCGTTGGCGTAGGGGGAGCTGTCCGC
GAGCCGGAGAAACCTTTCCACTGCACCGTCTGCGATCGTCGCTTTCGACA
GCTAAGCACACTGACCAACCATGTAAAGATCCATACTGGCGAGAAGCCCT
ACAAATGCAACGTTTGTGATAAGACCTTCCGTCAATCGTCGACGCTGACG
AACCATCTGAAGATCCATACGGGCGAGAAGCCTTATAACTGCAACTTTTG
TCCCAAGCATTTTCGACAACTGAGCACGCTGGCCAACCATGTGAAGATCC
ACACGGGTGAAAAGCCTTTTGAGTGTGTCATCTGCAAGAAGCAG

BO01058.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG5683-PA 927 Aef1-RA 1..828 17..844 4140 100 Plus
CG5683-PC 927 Aef1-RC 1..828 17..844 4140 100 Plus
CG5683-PB 927 Aef1-RB 1..828 17..844 4140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-RD 2684 CG5683-RD 475..1303 16..844 4145 100 Plus
Aef1-RB 2579 CG5683-RB 370..1198 16..844 4145 100 Plus
Aef1-RC 2622 CG5683-RC 413..1241 16..844 4145 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21435219..21436013 16..810 3975 100 Plus
3L 28110227 3L 21435814..21435937 695..818 215 78.2 Plus
3L 28110227 3L 21435898..21436014 611..727 195 77.8 Plus
3L 28110227 3L 21436072..21436110 806..844 195 100 Plus
Blast to na_te.dros performed on 2015-02-11 04:16:51 has no hits.

BO01058.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:11 Download gff for BO01058.5prime
Subject Subject Range Query Range Percent Splice Strand
Aef1-PB 1..828 17..844 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:51 Download gff for BO01058.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5683-PB 1..828 17..844 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 05:00:19 Download gff for BO01058.5prime
Subject Subject Range Query Range Percent Splice Strand
Aef1-RC 403..1241 2..844 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:06:05 Download gff for BO01058.5prime
Subject Subject Range Query Range Percent Splice Strand
Aef1-RC 403..1241 2..844 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:06:05 Download gff for BO01058.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 21436073..21436110 807..844 100   Plus
3L 21435209..21436009 2..806 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 05:00:19 Download gff for BO01058.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21429173..21429210 807..844 100   Plus
arm_3L 21428309..21429109 2..806 99 -> Plus

BO01058.complete Sequence

958 bp (958 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629407

> BO01058.complete
GAAGTTATCAGTCGACATGATGCATATCAAAAGCCTGCCCCATGCCCATG
CCGCTGCTACGGCGATGAGCAGTAACTGCGACATTGTCATAGTGGCCGCC
CAGCCCCAAACCACCATAGCAAACAATAATAACAATGAGACGGTCACCCA
GGCCACGCATCCGGCTCACATGGCGGCGGTTCAACAGCAGCAGCAACAAC
AACAGCAACAGCAGCAGCAACATCATCAGCAGCAGCAACAGCAGTCGAGC
GGACCACCCTCTGTGCCGCCGCCACCCACGGAACTCCCCTTGCCCTTCCA
GATGCACTTAAGCGGGATCTCGGCGGAGGCGCATAGTGCCGCCCAAGCAG
CGGCTATGGCAGCTGCCCAAGCTGCAGCAGCCCAAGCTGCTGCGGCGGAA
CAACAGCAACCGCCGCCACCAACTTCACATCTGACGCACCTGACCACGCA
TAGTCCGACAACGATCCACAGTGAGCATTACCTGGCCAATGGACATAGCG
AGCATCCCGGAGAGGGCAACGCTGCCGTTGGCGTAGGGGGAGCTGTCCGC
GAGCCGGAGAAACCTTTCCACTGCACCGTCTGCGATCGTCGCTTTCGACA
GCTAAGCACACTGACCAACCATGTAAAGATCCATACTGGCGAGAAGCCCT
ACAAATGCAACGTTTGTGATAAGACCTTCCGTCAATCGTCGACGCTGACG
AACCATCTGAAGATCCATACGGGCGAGAAGCCTTATAACTGCAACTTTTG
TCCCAAGCATTTTCGACAACTGAGCACGCTGGCCAACCATGTGAAGATCC
ACACGGGTGAAAAGCCTTTTGAGTGTGTCATCTGCAAGAAGCAGTTCCGA
CAGTCCAGCACGCTCAACAACCACATAAAAATACACGTCATGGACAAAGT
CTACGTTCCTGTTAAGATCAAAACAGAGGAGGATGAGGGGGCAAGCTTTC
TAGACCAT

BO01058.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-RD 1365 CG5683-PD 1..924 17..940 4620 100 Plus
Aef1-RB 927 CG5683-PB 1..924 17..940 4620 100 Plus
Aef1-RC 927 CG5683-PC 1..924 17..940 4620 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-RD 2684 CG5683-RD 475..1399 16..940 4625 100 Plus
Aef1-RB 2579 CG5683-RB 370..1294 16..940 4625 100 Plus
Aef1-RC 2622 CG5683-RC 413..1337 16..940 4625 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21435219..21436013 16..810 3975 100 Plus
3L 28110227 3L 21436072..21436206 806..940 675 100 Plus
3L 28110227 3L 21435814..21435937 695..818 215 78.2 Plus
3L 28110227 3L 21435898..21436014 611..727 195 77.8 Plus
Blast to na_te.dros performed on 2014-11-27 02:03:17 has no hits.

BO01058.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:40 Download gff for BO01058.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 1..927 17..943 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:44 Download gff for BO01058.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 349..1283 2..940 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:08:18 Download gff for BO01058.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RC 414..1337 17..942 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:40 Download gff for BO01058.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RB 349..1283 2..940 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:36:39 Download gff for BO01058.complete
Subject Subject Range Query Range Percent Splice Strand
Aef1-RC 414..1337 17..942 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:36:39 Download gff for BO01058.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21436073..21436206 807..942 98   Plus
3L 21435220..21436009 17..806 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:08:18 Download gff for BO01058.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21429173..21429306 807..942 98   Plus
arm_3L 21428320..21429109 17..806 100 -> Plus

BO01058.pep Sequence

Translation from 16 to 958

> BO01058.pep
MMHIKSLPHAHAAATAMSSNCDIVIVAAQPQTTIANNNNNETVTQATHPA
HMAAVQQQQQQQQQQQQQHHQQQQQQSSGPPSVPPPPTELPLPFQMHLSG
ISAEAHSAAQAAAMAAAQAAAAQAAAAEQQQPPPPTSHLTHLTTHSPTTI
HSEHYLANGHSEHPGEGNAAVGVGGAVREPEKPFHCTVCDRRFRQLSTLT
NHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNFCPKHFR
QLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVK
IKTEEDEGASFLDH

BO01058.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Aef1-PB 308 CG5683-PB 1..308 1..308 1653 100 Plus
Aef1-PC 308 CG5683-PC 1..308 1..308 1653 100 Plus
Aef1-PA 308 CG5683-PA 1..308 1..308 1653 100 Plus
Aef1-PD 454 CG5683-PD 1..308 1..308 1653 100 Plus
odd-PA 392 CG3851-PA 65..326 39..290 372 35.4 Plus