Clone BO01060 Report

Search the DGRC for BO01060

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptTfIIS-RA
Protein status:BO01060.pep: full length peptide match
Sequenced Size:973

Clone Sequence Records

BO01060.3prime Sequence

892 bp (813 high quality bases) assembled on 2005-11-30

> BO01060.3prime
ATGGTCTAGAAAGCTTGCGCAGAACTTCCATCGGTTGCCGCACTCGTTGC
ACATGACGAAGGTGGTCATAGGTTCATCGGCGGAACGAGTCTGCAGCTGG
TTGTAGGTGCAGTTGCGCTTCTTGCACTTGGCGCACTTGAGGAGATCGGT
CTTGGTGCCCTGCACGGTGGCCAGCTGGGCATCGTTGATGGCCTCCTTGA
CGAACTTCTCGCGCAGCTTCTTCATCTCATCGCTGGCCATCTCCTCCGGC
GTCATTTTGGCCAGCTGCTTGGCAGTGACGGCGCCGCACATAAAGTTGCC
TCGCAATCCAGGATTTTTGGGGTCCTTCAGATTGGCCACGCGTGACCTAA
TGCGATTCTTGTACTTCATATCCGTGTTATTGAACTCGGAGTAAATGGCA
TCCTCCAGTTCGGCGGCCATTTCCTCCGGCTCACCGCATCCTTCGGGCAC
TTCACCAATCTTCAGTGCGGTGGCCAGCATTTCGCGGCATTTGATGCGGA
CCGCATCTGTCATGCCGCCGGAGGGAAACGAGGTCTGTGACGAGGATGTC
GAGCCTTTCTTCTCTTTATCCTTGGATGAGCTGGATGAACTGGACTTATC
CTTGCCGGAGATTGACGACGACGACTTGGCGGCACTGGTGGACTTCGAGG
CACTGCTGTTGTTGGAGGAGCCCTCCTTAGCGGAGCTGTTGTTCGGTGTG
GTTGGCGCCGGGCTGGCGAGGAATCGTTTCCAGTTCTTGATCAGCGTCTT
GGCCAGAGCGATCACCTCGTCGTCCTTGCTACTCTTGCGCAGCTCGTTTA
CGGTCATGCCGATGCGCGTTTTGGTCAGAATGTCGAGATTGATGTTAAGC
GTTTGCAGGGCCTTCAGCAGGTCCAGAGGCTGATCCTGTCCT

BO01060.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG3710-PA 942 TfIIS-RA 66..939 892..19 4345 99.8 Minus
CG8117-PA 489 CG8117-RA 259..310 255..204 135 90.3 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-RB 1773 CG3710-RB 325..1198 892..19 4355 99.9 Minus
TfIIS-RA 1401 CG3710-RA 325..1198 892..19 4355 99.9 Minus
CG8117-RA 770 CG8117-RA 323..552 260..25 275 75.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15059494..15060366 19..891 4350 99.9 Plus
X 23542271 X 15644544..15644660 260..144 270 82.1 Minus
Blast to na_te.dros performed on 2015-02-13 13:15:08 has no hits.

BO01060.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:14 Download gff for BO01060.3prime
Subject Subject Range Query Range Percent Splice Strand
TfIIS-PA 66..942 15..892 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:56 Download gff for BO01060.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3710-PA 66..942 15..892 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:32:50 Download gff for BO01060.3prime
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 325..1203 12..892 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:48:17 Download gff for BO01060.3prime
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 325..1203 12..892 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:48:17 Download gff for BO01060.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 15059489..15060366 12..892 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:32:50 Download gff for BO01060.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15059489..15060366 12..892 99   Plus

BO01060.5prime Sequence

829 bp (711 high quality bases) assembled on 2005-11-30

> BO01060.5prime
GAAGTTATCAGTCGACATGAGCGTGGAGGAGGAAGTGTTTCGAATCCAAA
AGAAGATGAGCAAGATGGCCAGCGACGGCACAGGACAGGATCAGGCTCTG
GACCTGCTGAAGGCCCTGCAAACGCTTAACATCAATCTCGACATTCTGAC
CAAAACGCGCATCGGCATGACCGTAAACGAGCTGCGCAAGAGTAGCAAGG
ACGACGAGGTGATCGCTCTGGCCAAGACGCTGATCAAGAACTGGAAACGA
TTCCTCGCCAGCCCGGCGCCAACCACACCGAACAACAGCTCCGCTAAGGA
GGGCTCCTCCAACAACAGCAGTGCCTCGAAGTCCACCAGTGCCGCCAAGT
CGTCGTCGTCAATCTCCGGCAAGGATAAGTCCAGTTCATCCAGCTCATCC
AAGGATAAAGAGAAGAAAGGCTCGACATCCTCGTCACAGACCTCGTTTCC
CTCCGGCGGCATGACAGATGCGGTCCGCATCAAATGCCGCGAAATGCTGG
CCACCGCACTGAAGATTGGTGAAGTGCCCGAAGGATGCGGTGAGCCGGAG
GAAATGGCCGCCGAACTGGAGGATGCCATTTACTCCGAGTTCAATAACAC
GGATATGAAGTACAAGAATCGCATTAGGTCACGCGTGGCCAATCTGAAGG
ACCCCAAAAATCCTGGATTGCGAGGCAACTTTATGTGCGGCGCCGTCACT
GCCAAGCAGCTGGCCAAAATGACGCCGGAGGAGATGGCCAGCGATGAGAT
GAAGAAGCTGCGCGAGAAGTTCGTCAAGGAGGCCCATCACGATGCCCAGC
TGGCCACCGTGCAGGGGCACCAAGACCGA

BO01060.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG3710-PA 942 TfIIS-RA 1..768 17..784 3840 100 Plus
CG3710-PA 942 TfIIS-RA 773..800 789..816 140 100 Plus
CG8117-PA 489 CG8117-RA 259..310 719..770 135 90.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 05:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-RB 1773 CG3710-RB 260..1071 17..829 3995 99.6 Plus
TfIIS-RA 1401 CG3710-RA 260..1071 17..829 3995 99.6 Plus
CG8117-RA 770 CG8117-RA 323..383 714..774 200 88.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 05:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15059621..15060366 829..83 3625 99.3 Minus
2L 23513712 2L 15060432..15060498 83..17 335 100 Minus
X 23542271 X 15644544..15644604 714..774 200 88.5 Plus
Blast to na_te.dros performed on 2015-02-13 05:54:49 has no hits.

BO01060.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:15 Download gff for BO01060.5prime
Subject Subject Range Query Range Percent Splice Strand
TfIIS-PA 1..811 17..828 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:15:57 Download gff for BO01060.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3710-PA 1..811 17..828 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 17:49:12 Download gff for BO01060.5prime
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 260..1070 17..828 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 07:57:04 Download gff for BO01060.5prime
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 260..1070 17..828 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 07:57:04 Download gff for BO01060.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 15060433..15060498 17..82 100   Minus
2L 15059622..15060366 83..828 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 17:49:12 Download gff for BO01060.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15060433..15060498 17..82 100   Minus
arm_2L 15059622..15060366 83..828 99 <- Minus

BO01060.complete Sequence

973 bp (973 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629408

> BO01060.complete
GAAGTTATCAGTCGACATGAGCGTGGAGGAGGAAGTGTTTCGAATCCAAA
AGAAGATGAGCAAGATGGCCAGCGACGGCACAGGACAGGATCAGGCTCTG
GACCTGCTGAAGGCCCTGCAAACGCTTAACATCAATCTCGACATTCTGAC
CAAAACGCGCATCGGCATGACCGTAAACGAGCTGCGCAAGAGTAGCAAGG
ACGACGAGGTGATCGCTCTGGCCAAGACGCTGATCAAGAACTGGAAACGA
TTCCTCGCCAGCCCGGCGCCAACCACACCGAACAACAGCTCCGCTAAGGA
GGGCTCCTCCAACAACAGCAGTGCCTCGAAGTCCACCAGTGCCGCCAAGT
CGTCGTCGTCAATCTCCGGCAAGGATAAGTCCAGTTCATCCAGCTCATCC
AAGGATAAAGAGAAGAAAGGCTCGACATCCTCGTCACAGACCTCGTTTCC
CTCCGGCGGCATGACAGATGCGGTCCGCATCAAATGCCGCGAAATGCTGG
CCACCGCACTGAAGATTGGTGAAGTGCCCGAAGGATGCGGTGAGCCGGAG
GAAATGGCCGCCGAACTGGAGGATGCCATTTACTCCGAGTTCAATAACAC
GGATATGAAGTACAAGAATCGCATTAGGTCACGCGTGGCCAATCTGAAGG
ACCCCAAAAATCCTGGATTGCGAGGCAACTTTATGTGCGGCGCCGTCACT
GCCAAGCAGCTGGCCAAAATGACGCCGGAGGAGATGGCCAGCGATGAGAT
GAAGAAGCTGCGCGAGAAGTTCGTCAAGGAGGCCATCAACGATGCCCAGC
TGGCCACCGTGCAGGGCACCAAGACCGATCTCCTCAAGTGCGCCAAGTGC
AAGAAGCGCAACTGCACCTACAACCAGCTGCAGACTCGTTCCGCCGATGA
ACCTATGACCACCTTCGTCATGTGCAACGAGTGCGGCAACCGATGGAAGT
TCTGCGCAAGCTTTCTAGACCAT

BO01060.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-RB 942 CG3710-PB 1..939 17..955 4695 100 Plus
TfIIS-RA 942 CG3710-PA 1..939 17..955 4695 100 Plus
CG8117-RA 489 CG8117-PA 254..370 714..830 270 82.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-RB 1773 CG3710-RB 260..1198 17..955 4695 100 Plus
TfIIS-RA 1401 CG3710-RA 260..1198 17..955 4695 100 Plus
CG8117-RA 770 CG8117-RA 323..439 714..830 270 82.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15059494..15060366 955..83 4365 100 Minus
2L 23513712 2L 15060432..15060498 83..17 335 100 Minus
X 23542271 X 15644544..15644660 714..830 270 82.1 Plus
Blast to na_te.dros performed on 2014-11-27 13:44:12 has no hits.

BO01060.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:08 Download gff for BO01060.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 1..942 17..959 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:02 Download gff for BO01060.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 256..1199 17..962 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:23:30 Download gff for BO01060.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 260..1198 17..957 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:08 Download gff for BO01060.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 256..1199 17..962 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:54:46 Download gff for BO01060.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIS-RA 260..1198 17..957 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:54:46 Download gff for BO01060.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15060433..15060498 17..82 100   Minus
2L 15059492..15060366 83..957 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:30 Download gff for BO01060.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15060433..15060498 17..82 100   Minus
arm_2L 15059492..15060366 83..957 99 <- Minus

BO01060.pep Sequence

Translation from 16 to 973

> BO01060.pep
MSVEEEVFRIQKKMSKMASDGTGQDQALDLLKALQTLNINLDILTKTRIG
MTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNN
SSASKSTSAAKSSSSISGKDKSSSSSSSKDKEKKGSTSSSQTSFPSGGMT
DAVRIKCREMLATALKIGEVPEGCGEPEEMAAELEDAIYSEFNNTDMKYK
NRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLRE
KFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTF
VMCNECGNRWKFCASFLDH

BO01060.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIS-PB 313 CG3710-PB 1..313 1..313 1589 100 Plus
TfIIS-PA 313 CG3710-PA 1..313 1..313 1589 100 Plus
CG8117-PA 162 CG8117-PA 1..161 149..311 576 63.8 Plus
pps-PA 2016 CG6525-PA 1219..1409 95..277 157 29.5 Plus
pps-PB 2018 CG6525-PB 1221..1411 95..277 157 29.5 Plus