Clone BO01070 Report

Search the DGRC for BO01070

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:70
Vector:pDNR-Dual
Associated Gene/Transcriptstck-RA
Protein status:BO01070.pep: full length peptide match
Sequenced Size:1039

Clone Sequence Records

BO01070.3prime Sequence

878 bp (818 high quality bases) assembled on 2005-11-30

> BO01070.3prime
ATGGTCTAGAAAGCTTGCGGTGTTCTTTTTCATTGTCATCTCGTGGGCGG
TGCGCAGACGTCGTCTGAGTTCGTTTGGAAATCGGTCATAGCACTTTTTG
CACACCGGCTTCTCGTCGTACTCGTAGAATTTCGATTTTTGTGTCATCTT
CGTGTCGCACACGGAGCACGCAAAGTGGTGCACACACCAGGCCTTGTTCA
AGGCAGTGAAAACATCGCCTCCAATAACCTGGTTGCAGACGAAGCACAGG
TTGCCAAAGAGCTGATGATAGTGCGTCTCGCAGTAGGCCAATCCCCGCTT
CTCGTAGTGTCGGTGACCCAAGAAGGGTTTCTCGCACTTGGCGCACACGA
AATGTTCCACATGCCAGTGCTTTCCGAGCGCCGTTACCACCCTCTCCTCA
ATCGGACGACGACAGGCACCACATATGGGAATGCCCATTTTATCGTGACA
ACGCAGACAATACAGTTCGTTCATATCGTTAGCAGCCAATCCTGGCCGGC
TCTTGACCTCCCGAGCAGTGGAATCCAACTCTGTGCCGCAGGCCGTGCAA
CTGAAGTGATAGCCGTGGTACACTTCGCCCCGGAATCGCAAAGGCTCCTC
GTCGATGAGGCCGTGGCATTTTTGGCATACATAGCGGCCGGTAATCTCCG
CCTTCACCTTGGCATTGCACTCGTGACACAAGGCGCGGTTCTGGTTCTTG
ATGAATCCGCAATCAGCCAGCTCCTTGGCGCACAATTGGCAGCGGAAGCA
CTGTGGATGCCAGCTAGCTGACATGGCCTTGATGACCCGTCCGATGACGA
ACTCGCCGCACTTGTTGCAGCAGGGAGCGAAGAGCACGTGAAAGTCGCGT
TCACAGTACTTACGGCCCTCGAACTCGT

BO01070.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG7954-PA 1008 stck-RA 146..1005 878..19 4300 100 Minus
CG7954-PB 1038 stck-RB 176..1035 878..19 4300 100 Minus
CG7954-PC 1047 stck-RC 185..1044 878..19 4300 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RD 1500 CG7954-RD 400..1259 878..19 4300 100 Minus
stck-RC 1335 CG7954-RC 239..1098 878..19 4300 100 Minus
stck-RB 1388 CG7954-RB 288..1147 878..19 4300 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8358690..8358954 878..614 1325 100 Minus
3R 32079331 3R 8359206..8359465 472..213 1300 100 Minus
3R 32079331 3R 8359529..8359723 213..19 975 100 Minus
3R 32079331 3R 8359009..8359150 613..472 710 100 Minus
Blast to na_te.dros performed on 2015-02-13 13:16:54 has no hits.

BO01070.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:27 Download gff for BO01070.3prime
Subject Subject Range Query Range Percent Splice Strand
stck-PA 146..1008 15..878 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:16:16 Download gff for BO01070.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7954-PC 185..1047 15..878 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:32:58 Download gff for BO01070.3prime
Subject Subject Range Query Range Percent Splice Strand
stck-RB 288..1156 10..878 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:52:52 Download gff for BO01070.3prime
Subject Subject Range Query Range Percent Splice Strand
stck-RB 288..1156 10..878 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:52:52 Download gff for BO01070.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 8359530..8359732 10..212 98   Minus
3R 8359207..8359465 213..471 100 -> Minus
3R 8359009..8359150 472..613 100 -> Minus
3R 8358690..8358954 614..878 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:32:58 Download gff for BO01070.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4185252..4185454 10..212 98   Minus
arm_3R 4184929..4185187 213..471 100 -> Minus
arm_3R 4184731..4184872 472..613 100 -> Minus
arm_3R 4184412..4184676 614..878 100 -> Minus

BO01070.5prime Sequence

886 bp (779 high quality bases) assembled on 2005-11-30

> BO01070.5prime
GAAGTTATCAGTCGACATGTCGCTGGGTGCCATGCATTGTACGCGATGTG
CCGACGGCTTCGAGCCGACTGAGAAGATTGTTAACTCCAATGGAGAACTC
TGGCACACCCAGTGCTTCGTATGTGCCCAGTGCTTCCGACCCTTCCAGGA
TGGGATATTCTACGAGTTCGAGGGCCGTAAGTACTGTGAACGCGACTTTC
ACGTGCTCTTCGCTCCCTGCTGCAACAAGTGCGGCGAGTTCGTCATCGGA
CGGGTCATCAAGGCCATGTCAGCTAGCTGGCATCCACAGTGCTTCCGCTG
CCAATTGTGCGCCAAGGAGCTGGCTGATTGCGGATTCATCAAGAACCAGA
ACCGCGCCTTGTGTCACGAGTGCAATGCCAAGGTGAAGGCGGAGATTACC
GGCCGCTATGTATGCCAAAAATGCCACGGCCTCATCGACGAGGAGCCTTT
GCGATTCCGGGGCGAAGTGTACCACGGCTATCACTTCAGTTGCACGGCCT
GCGGCACAGAGTTGGATTCCACTGCTCGGGAGGTCAAGAGCCGGCCAGGA
TTGGCTGCTAACGATATGAACGAACTGTATTGTCTGCGTTGTCACGATAA
AATGGGCATTCCCATATGTGGTGCCTGTCGTCGTCCGATTGAGGAGAGGG
TGGTAACGGCGCTCGGAAAGCACTGGCATGTGGAACATTTCGTGTGCGCC
AAGTGCGAGAAACCCTTCTTGGGTCACCGACACTACGAGAAGCGGGGATT
GGCCTACTGCGAGACGCACTATCATCAGCTCTTTGGCAACCTGTGCTTCG
TCTGCAACCAGGTTATTGGAGGCGATGTTTTCACTGCCTTGAACAAAGCC
TGGTGTGTGCACCACTTTGCGTGCTCCGTGTGCGAC

BO01070.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG7954-PB 1038 stck-RB 29..900 15..886 4335 99.8 Plus
CG7954-PC 1047 stck-RC 38..909 15..886 4335 99.8 Plus
CG7954-PA 1008 stck-RA 1..870 17..886 4325 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RD 1500 CG7954-RD 253..1124 15..886 4345 99.9 Plus
stck-RC 1335 CG7954-RC 92..963 15..886 4345 99.9 Plus
stck-RB 1388 CG7954-RB 141..1012 15..886 4345 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8358649..8358954 121..426 1530 100 Plus
3R 32079331 3R 8359206..8359465 568..827 1300 100 Plus
3R 32079331 3R 8359009..8359150 427..568 710 100 Plus
3R 32079331 3R 8358485..8358590 15..120 530 100 Plus
3R 32079331 3R 8359529..8359588 827..886 285 98.3 Plus
Blast to na_te.dros performed on 2015-02-10 15:15:44 has no hits.

BO01070.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:28 Download gff for BO01070.5prime
Subject Subject Range Query Range Percent Splice Strand
stck-PB 23..900 9..886 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:16:17 Download gff for BO01070.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7954-PC 32..909 9..886 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:32:59 Download gff for BO01070.5prime
Subject Subject Range Query Range Percent Splice Strand
stck-RB 135..1012 9..886 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:13:41 Download gff for BO01070.5prime
Subject Subject Range Query Range Percent Splice Strand
stck-RB 135..1012 9..886 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:13:41 Download gff for BO01070.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 8359530..8359588 828..886 98   Plus
3R 8359207..8359465 569..827 100 -> Plus
3R 8359009..8359150 427..568 100 -> Plus
3R 8358649..8358954 121..426 100 -> Plus
3R 8358479..8358590 9..120 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:32:59 Download gff for BO01070.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4185252..4185310 828..886 98   Plus
arm_3R 4184929..4185187 569..827 100 -> Plus
arm_3R 4184731..4184872 427..568 100 -> Plus
arm_3R 4184371..4184676 121..426 100 -> Plus
arm_3R 4184201..4184312 9..120 98 -> Plus

BO01070.complete Sequence

1039 bp (1039 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629411

> BO01070.complete
GAAGTTATCAGTCGACATGTCGCTGGGTGCCATGCATTGTACGCGATGTG
CCGACGGCTTCGAGCCGACTGAGAAGATTGTTAACTCCAATGGAGAACTC
TGGCACACCCAGTGCTTCGTATGTGCCCAGTGCTTCCGACCCTTCCAGGA
TGGGATATTCTACGAGTTCGAGGGCCGTAAGTACTGTGAACGCGACTTTC
ACGTGCTCTTCGCTCCCTGCTGCAACAAGTGCGGCGAGTTCGTCATCGGA
CGGGTCATCAAGGCCATGTCAGCTAGCTGGCATCCACAGTGCTTCCGCTG
CCAATTGTGCGCCAAGGAGCTGGCTGATTGCGGATTCATCAAGAACCAGA
ACCGCGCCTTGTGTCACGAGTGCAATGCCAAGGTGAAGGCGGAGATTACC
GGCCGCTATGTATGCCAAAAATGCCACGGCCTCATCGACGAGGAGCCTTT
GCGATTCCGGGGCGAAGTGTACCACGGCTATCACTTCAGTTGCACGGCCT
GCGGCACAGAGTTGGATTCCACTGCTCGGGAGGTCAAGAGCCGGCCAGGA
TTGGCTGCTAACGATATGAACGAACTGTATTGTCTGCGTTGTCACGATAA
AATGGGCATTCCCATATGTGGTGCCTGTCGTCGTCCGATTGAGGAGAGGG
TGGTAACGGCGCTCGGAAAGCACTGGCATGTGGAACATTTCGTGTGCGCC
AAGTGCGAGAAACCCTTCTTGGGTCACCGACACTACGAGAAGCGGGGATT
GGCCTACTGCGAGACGCACTATCATCAGCTCTTTGGCAACCTGTGCTTCG
TCTGCAACCAGGTTATTGGAGGCGATGTTTTCACTGCCTTGAACAAGGCC
TGGTGTGTGCACCACTTTGCGTGCTCCGTGTGCGACACGAAGATGACACA
AAAATCGAAATTCTACGAGTACGACGAGAAGCCGGTGTGCAAAAAGTGCT
ATGACCGATTTCCAAACGAACTCAGACGACGTCTGCGCACCGCCCACGAG
ATGACAATGAAAAAGAACACCGCAAGCTTTCTAGACCAT

BO01070.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RC 1047 CG7954-PC 38..1044 15..1021 5035 100 Plus
stck-RB 1038 CG7954-PB 29..1035 15..1021 5035 100 Plus
stck-RD 1008 CG7954-PD 1..1005 17..1021 5025 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RD 1500 CG7954-RD 253..1259 15..1021 5035 100 Plus
stck-RC 1335 CG7954-RC 92..1098 15..1021 5035 100 Plus
stck-RB 1388 CG7954-RB 141..1147 15..1021 5035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8358649..8358954 121..426 1530 100 Plus
3R 32079331 3R 8359206..8359465 568..827 1300 100 Plus
3R 32079331 3R 8359529..8359723 827..1021 975 100 Plus
3R 32079331 3R 8359009..8359150 427..568 710 100 Plus
3R 32079331 3R 8358485..8358590 15..120 530 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:48:53 has no hits.

BO01070.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:26 Download gff for BO01070.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RC 32..1047 9..1025 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:26 Download gff for BO01070.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RC 78..1099 9..1030 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:34:59 Download gff for BO01070.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 143..1147 17..1023 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:27 Download gff for BO01070.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RC 78..1099 9..1030 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:10:27 Download gff for BO01070.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 143..1147 17..1023 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:10:27 Download gff for BO01070.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8359530..8359723 828..1023 98   Plus
3R 8359207..8359465 569..827 100 -> Plus
3R 8359009..8359150 427..568 100 -> Plus
3R 8358649..8358954 121..426 100 -> Plus
3R 8358487..8358590 17..120 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:34:59 Download gff for BO01070.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4185252..4185445 828..1023 98   Plus
arm_3R 4184929..4185187 569..827 100 -> Plus
arm_3R 4184731..4184872 427..568 100 -> Plus
arm_3R 4184371..4184676 121..426 100 -> Plus
arm_3R 4184209..4184312 17..120 100 -> Plus

BO01070.pep Sequence

Translation from 16 to 1039

> BO01070.pep
MSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYE
FEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAK
ELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGE
VYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPI
CGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCET
HYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFY
EYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKKNTASFLDH

BO01070.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
stck-PD 335 CG7954-PD 1..335 1..335 1920 100 Plus
stck-PA 335 CG7954-PA 1..335 1..335 1920 100 Plus
stck-PB 345 CG7954-PB 11..345 1..335 1920 100 Plus
stck-PC 348 CG7954-PC 14..348 1..335 1920 100 Plus
Pax-PB 556 CG31794-PB 322..553 68..314 400 32.7 Plus