Clone BO01074 Report

Search the DGRC for BO01074

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptCG1407-RB
Protein status:BO01074.pep: full length peptide match
Sequenced Size:1048

Clone Sequence Records

BO01074.3prime Sequence

843 bp (736 high quality bases) assembled on 2005-11-30

> BO01074.3prime
ATGGTCTAGAAAGCTTGCTGGAATCGAGTCTTGAAATCGCGGCTCTGGCA
GAAAGTCCTCCTCCAACTCGATGCGCGTATCGCTGTGATATCCTAGCAAA
GATTCCGTGTCCTCTTCCATATGTCGAATCGGAAATGTTTTGCCATCGCC
AAAGCTCGAAAACACGGGCAGGAACCAGTATTGCCAGTCGTCACCAAATA
CTTCGCAGAAATTGGCATAACGCCCCAAGTTATAACCATTCTTATCGGGG
CCGCCAACGCGGAAGATCGGAGCCCTGAACGACTCCAATGTCGTGCGATT
CACCAGCACAAGGTAGATGTGGTAGCCAAATAAACTCACCAAACTAATGG
CAAACATAATGGCAATGAAGAACAGGAACAAGATGTGAAAACGACCCATT
CCACTGGCATTTAGCTGTCCTGCACCTACCTTCCAGAACTCGACAAAGTC
GTGTAGCGAGGTAAAAGCCACATACAGGCAGTAGACAAGAGCATAGCCCA
GGAACAACACGAAGTACTTGTAGTTGTAAAAGTTAACGCAGTTGTTTACC
CAGGGGCAGTGGTGATCCATCTTCAGTACGCAGCAACTGCACACACTACA
GTGGTGAGCTCGGTCTGGCTTGATGATCTTGCACTTTTCGCAGAACCGCA
CCGAACCATTCATTGTGCGATTCGTTACTGGCAAATCGCGCGCAAAGTTG
TTAAGAATGCGTTTCTGGGTGTCCGGGCTGTCGGCTCGGAAAAGTCGCGA
CACTTCCTCATCCGGTATCCTCCATTGATCTGGTATTCGGCCTACGGAGG
TCATTATGGTGCGCCAGTACGACCACATGAACAGGGTGAGGAA

BO01074.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-PB 1017 CG1407-RB 190..1014 843..19 4125 100 Minus
CG1407-PA 1332 CG1407-RA 190..878 843..155 3445 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-RD 1857 CG1407-RD 554..1378 843..19 4125 100 Minus
CG1407-RB 1857 CG1407-RB 554..1378 843..19 4125 100 Minus
CG1407-RA 2238 CG1407-RA 554..1242 843..155 3445 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10031579..10031827 420..668 1245 100 Plus
2R 25286936 2R 10028922..10029059 19..156 690 100 Plus
2R 25286936 2R 10031284..10031419 285..420 680 100 Plus
2R 25286936 2R 10031085..10031215 155..285 655 100 Plus
2R 25286936 2R 10032019..10032125 668..774 535 100 Plus
2R 25286936 2R 10032214..10032282 775..843 345 100 Plus
Blast to na_te.dros performed on 2015-02-04 18:43:26 has no hits.

BO01074.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:33 Download gff for BO01074.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1407-PB 192..1017 18..841 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:16:25 Download gff for BO01074.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1407-PB 192..1017 18..841 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:11:01 Download gff for BO01074.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 554..1383 12..843 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:26:04 Download gff for BO01074.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 554..1383 12..843 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:26:04 Download gff for BO01074.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 10032214..10032282 775..843 100   Plus
2R 10032019..10032125 668..774 100 <- Plus
2R 10031580..10031826 421..667 100 <- Plus
2R 10031284..10031419 285..420 100 <- Plus
2R 10031085..10031214 155..284 100 <- Plus
2R 10028917..10029057 12..154 97 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:11:01 Download gff for BO01074.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5919719..5919787 775..843 100   Plus
arm_2R 5919524..5919630 668..774 100 <- Plus
arm_2R 5919085..5919331 421..667 100 <- Plus
arm_2R 5918789..5918924 285..420 100 <- Plus
arm_2R 5918590..5918719 155..284 100 <- Plus
arm_2R 5916422..5916562 12..154 97 <- Plus

BO01074.5prime Sequence

803 bp (766 high quality bases) assembled on 2005-11-29

> BO01074.5prime
GAAGTTATCAGTCGACATGGGTAACGACGATCATCGACGGCGGAAGACAC
CCTGCGGATTTTGTATGGCAGTCTTCAAATGGATACCAGTGCTATTTATC
ACCGCGGTAATAGCTTGGTCCTATTACGCTTATGTGGTGGAGCTATGCAT
CCGCAACTCGGAGAACCGCATTGGTATGATCTTCATGCTTCTGTTCTACC
ACCTCTTCCTCACCCTGTTCATGTGGTCGTACTGGCGCACCATAATGACC
TCCGTAGGCCGAATACCAGATCAATGGAGGATACCGGATGAGGAAGTGTC
GCGACTTTTCCGAGCCGACAGCCCGGACACCCAGAAACGCATTCTTAACA
ACTTTGCGCGCGATTTGCCAGTAACGAATCGCACAATGAATGGTTCGGTG
CGGTTCTGCGAAAAGTGCAAGATCATCAAGCCAGACCGAGCTCACCACTG
TAGTGTGTGCAGTTGCTGCGTACTGAAGATGGATCACCACTGCCCCTGGG
TAAACAACTGCGTTAACTTTTACAACTACAAGTACTTCGTGTTGTTCCTG
GGCTATGCTCTTGTCTACTGCCTGTATGTGGCTTTTACCTCGCTACACGA
CTTTGTCGAGTTCTGGAAGGTAGGTGCAGGACAGCTAAATGCCAGTGGAA
TGGGTCGTTTTCACATCTTGTTCCTGTTCTTCATTGCCATTATGTTTGCC
ATTAGTTTGGTGAGTTTATTTGGCTACCACATCTACCTTGTGCTGGTGAA
TCGCACGACATTGGAGTCGTTCAGGGCTCCGATCTTCCCGCGTGGCGGCC
CCG

BO01074.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-PB 1017 CG1407-RB 1..772 17..788 3860 100 Plus
CG1407-PA 1332 CG1407-RA 1..772 17..788 3860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-RD 1857 CG1407-RD 365..1151 17..803 3890 99.7 Plus
CG1407-RA 2238 CG1407-RA 365..1151 17..803 3890 99.7 Plus
CG1407-RB 1857 CG1407-RB 365..1151 17..803 3890 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10031579..10031827 629..381 1245 100 Minus
2R 25286936 2R 10032393..10032529 153..17 685 100 Minus
2R 25286936 2R 10031284..10031419 764..629 680 100 Minus
2R 25286936 2R 10032214..10032335 274..153 610 100 Minus
2R 25286936 2R 10032019..10032125 381..275 535 100 Minus
Blast to na_te.dros performed on 2015-02-13 00:59:04 has no hits.

BO01074.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:34 Download gff for BO01074.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1407-PB 1..787 17..803 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:16:26 Download gff for BO01074.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1407-PA 1..787 17..803 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:28:20 Download gff for BO01074.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 356..1151 7..803 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:00:30 Download gff for BO01074.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 356..1151 7..803 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:00:30 Download gff for BO01074.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 10032394..10032538 7..152 97   Minus
2R 10032214..10032335 153..274 100 <- Minus
2R 10032019..10032125 275..381 100 <- Minus
2R 10031580..10031826 382..628 100 <- Minus
2R 10031284..10031419 629..764 100 <- Minus
2R 10031176..10031214 765..803 95 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:28:20 Download gff for BO01074.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5919899..5920043 7..152 97   Minus
arm_2R 5919719..5919840 153..274 100 <- Minus
arm_2R 5919524..5919630 275..381 100 <- Minus
arm_2R 5919085..5919331 382..628 100 <- Minus
arm_2R 5918789..5918924 629..764 100 <- Minus
arm_2R 5918681..5918719 765..803 95 <- Minus

BO01074.complete Sequence

1048 bp (1048 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629412

> BO01074.complete
GAAGTTATCAGTCGACATGGGTAACGACGATCATCGACGGCGGAAGACAC
CCTGCGGATTTTGTATGGCAGTCTTCAAATGGATACCAGTGCTATTTATC
ACCGCGGTAATAGCTTGGTCCTATTACGCTTATGTGGTGGAGCTATGCAT
CCGCAACTCGGAGAACCGCATTGGTATGATCTTCATGCTTCTGTTCTACC
ACCTCTTCCTCACCCTGTTCATGTGGTCGTACTGGCGCACCATAATGACC
TCCGTAGGCCGAATACCAGATCAATGGAGGATACCGGATGAGGAAGTGTC
GCGACTTTTCCGAGCCGACAGCCCGGACACCCAGAAACGCATTCTTAACA
ACTTTGCGCGCGATTTGCCAGTAACGAATCGCACAATGAATGGTTCGGTG
CGGTTCTGCGAAAAGTGCAAGATCATCAAGCCAGACCGAGCTCACCACTG
TAGTGTGTGCAGTTGCTGCGTACTGAAGATGGATCACCACTGCCCCTGGG
TAAACAACTGCGTTAACTTTTACAACTACAAGTACTTCGTGTTGTTCCTG
GGCTATGCTCTTGTCTACTGCCTGTATGTGGCTTTTACCTCGCTACACGA
CTTTGTCGAGTTCTGGAAGGTAGGTGCAGGACAGCTAAATGCCAGTGGAA
TGGGTCGTTTTCACATCTTGTTCCTGTTCTTCATTGCCATTATGTTTGCC
ATTAGTTTGGTGAGTTTATTTGGCTACCACATCTACCTTGTGCTGGTGAA
TCGCACGACATTGGAGTCGTTCAGGGCTCCGATCTTCCGCGTTGGCGGCC
CCGATAAGAATGGTTATAACTTGGGGCGTTATGCCAATTTCTGCGAAGTA
TTTGGTGACGACTGGCAATACTGGTTCCTGCCCGTGTTTTCGAGCTTTGG
CGATGGCAAAACATTTCCGATTCGACATATGGAAGAGGACACGGAATCTT
TGCTAGGATATCACAGCGATACGCGCATCGAGTTGGAGGAGGACTTTCTG
CCAGAGCCGCGATTTCAAGACTCGATTCCAGCAAGCTTTCTAGACCAT

BO01074.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-RD 1059 CG1407-PD 1..1014 17..1030 5070 100 Plus
CG1407-RB 1017 CG1407-PB 1..1014 17..1030 5070 100 Plus
CG1407-RA 1332 CG1407-PA 1..878 17..894 4390 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-RD 1857 CG1407-RD 365..1378 17..1030 5070 100 Plus
CG1407-RB 1857 CG1407-RB 365..1378 17..1030 5070 100 Plus
CG1407-RA 2238 CG1407-RA 365..1242 17..894 4390 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10031579..10031827 629..381 1245 100 Minus
2R 25286936 2R 10028922..10029059 1030..893 690 100 Minus
2R 25286936 2R 10032393..10032529 153..17 685 100 Minus
2R 25286936 2R 10031284..10031419 764..629 680 100 Minus
2R 25286936 2R 10031085..10031215 894..764 655 100 Minus
2R 25286936 2R 10032214..10032335 274..153 610 100 Minus
2R 25286936 2R 10032019..10032125 381..275 535 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:05:08 has no hits.

BO01074.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:28 Download gff for BO01074.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 1..1017 17..1031 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:28 Download gff for BO01074.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 351..1378 7..1037 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:26:41 Download gff for BO01074.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 365..1378 17..1032 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:28 Download gff for BO01074.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 351..1378 7..1037 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:10:35 Download gff for BO01074.complete
Subject Subject Range Query Range Percent Splice Strand
CG1407-RB 365..1378 17..1032 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:10:35 Download gff for BO01074.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10032394..10032529 17..152 100   Minus
2R 10032214..10032335 153..274 100 <- Minus
2R 10032019..10032125 275..381 100 <- Minus
2R 10031580..10031826 382..628 100 <- Minus
2R 10031284..10031419 629..764 100 <- Minus
2R 10031085..10031214 765..894 100 <- Minus
2R 10028918..10029057 895..1032 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:26:41 Download gff for BO01074.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5919899..5920034 17..152 100   Minus
arm_2R 5919719..5919840 153..274 100 <- Minus
arm_2R 5919524..5919630 275..381 100 <- Minus
arm_2R 5919085..5919331 382..628 100 <- Minus
arm_2R 5918789..5918924 629..764 100 <- Minus
arm_2R 5918590..5918719 765..894 100 <- Minus
arm_2R 5916423..5916562 895..1032 98 <- Minus

BO01074.pep Sequence

Translation from 16 to 1048

> BO01074.pep
MGNDDHRRRKTPCGFCMAVFKWIPVLFITAVIAWSYYAYVVELCIRNSEN
RIGMIFMLLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRA
DSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSC
CVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFW
KVGAGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLE
SFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFLPVFSSFGDGKTF
PIRHMEEDTESLLGYHSDTRIELEEDFLPEPRFQDSIPASFLDH

BO01074.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG1407-PB 338 CG1407-PB 1..338 1..338 1869 100 Plus
CG1407-PD 352 CG1407-PD 1..338 1..338 1869 100 Plus
CG1407-PA 443 CG1407-PA 1..301 1..301 1650 98.7 Plus
CG1407-PG 452 CG1407-PG 1..310 1..301 1630 95.8 Plus
CG1407-PE 440 CG1407-PE 1..298 1..301 1622 97.7 Plus