Clone BO01082 Report

Search the DGRC for BO01082

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptTbp-RA
Protein status:BO01082.pep: full length peptide match
Sequenced Size:1093

Clone Sequence Records

BO01082.3prime Sequence

860 bp (858 high quality bases) assembled on 2005-11-30

> BO01082.3prime
ATGGTCTAGAAAGCTTGCTGACTGCTTCTTGAACTTCTTTAAAATGGGGA
ATATCTTGTCGAAGGCATCGTAGATCTCCTGCCGCACCTTTGCTCCAGTG
AGCACCACCTTTCCGGACACGAAGATGAGGAGCACGATTCGAGGTCGCAC
CATACGATAGATTAAGCCGGGAAATAGCTCAGGCTCGTAGCTGCTGAAGT
TGCAATGGGTCAGCACCAGGCCTTCCAAGCGTATGGGGAACTTGACATCG
CAGGAGCCGACCATGTTTTGAATCTTAAAGTCGAGGAACTTTGCAGGGAA
ACCGAGCTTTTGGATGATGCGCGCATACTTTCTCGCTGCCAGTCTGGAGT
CGTCCTCACTCTTTGCCCCTGTGCACACCATCTTGCCGGAGCTGAAAATA
AGGGCGGTGGTCCGGGGCTCTCGGATTCGCATAATCACAGCCGCAAATCG
CTTAGGATTGTACTCGGCGTTTCTCGCATGCAATGCTATTTTCTTGAGGT
CCAGTTTGCAGCACAGATTAACCGTGGACACGATGTTCTGAAGTTGTGGC
ACAATACCGGGATCAGCGGAACCTGGTGTGGCTGGTGTCATCGGCGTGGA
GGGGCCCATCGTCTGGTGGATGTTGCTCAGGGCATCTCCGCCACCTCCGG
CCCCCGAACCGCCCACACTCCGCTCACTCATGGGCATCATGTGGGCCATC
ATGCTCTGCGGCGTCTGCGGCTGCATCATGGACTGCGGAGTGCTCCCACC
GCCGCCGGGCGCCTGACTCTGGAGCTGCTGTTGCTGCTGCTGCTGCTGAT
AGGAGGCCGATGGCTGGTAACTCTGCATTTTGTTGTGCGCCAGCGGGAGC
GATGGTTCGT

BO01082.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG9874-PA 1062 Tbp-RA 218..1059 860..19 4160 99.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 18:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-RA 1387 CG9874-RA 408..1249 860..19 4180 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 18:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21686669..21687235 294..860 2805 99.6 Plus
2R 25286936 2R 21686330..21686605 19..294 1380 100 Plus
Blast to na_te.dros performed on 2015-02-09 18:12:13 has no hits.

BO01082.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:48 Download gff for BO01082.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9874-PA 218..1062 15..860 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:16:48 Download gff for BO01082.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9874-PA 218..1062 15..860 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 03:53:26 Download gff for BO01082.3prime
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 408..1252 15..860 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:08:54 Download gff for BO01082.3prime
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 408..1252 15..860 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:08:54 Download gff for BO01082.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 21686670..21687235 295..860 99   Plus
2R 21686326..21686605 15..294 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 03:53:26 Download gff for BO01082.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17574175..17574740 295..860 99   Plus
arm_2R 17573831..17574110 15..294 99 <- Plus

BO01082.5prime Sequence

888 bp (811 high quality bases) assembled on 2005-11-30

> BO01082.5prime
GAAGTTATCAGTCGACATGGACCAAATGCTAAGCCCCAACTTCTCGATTC
CGAGCATCGGAACGCCGCTCCACCAGATGGAAGCGGACCAGCAGATAGTG
GCCAATCCTGTGTACCATCCTCCGGCTGTATCGCAGCCGGATTCGTTGAT
GCCGGCACCCGGTTCCAGTTCCGTGCAGCACCAGCAGCAGCAACAGCAGT
CGGACGCCAGTGGGGGATCAGGTCTCTTTGGCCACGAACCATCGCTCCCG
CTGGCGCACAAACAAATGCAGAGTTACCAGCCATCGGCCTCCTATCAGCA
GCAGCAGCAGCAACAGCAGCTCCAGAGTCAGGCGCCCGGCGGCGGTGGGA
GCACTCCGCAGTCCATGATGCAGCCGCAGACGCCGCAGAGCATGATGGCC
CACATGATGCCCATGAGTGAGCGGAGTGTGGGCGGTTCGGGGGCCGGAGG
TGGCGGAGATGCCCTGAGCAACATCCACCAGACGATGGGCCCCTCCACGC
CGATGACACCAGCCACACCAGGTTCCGCTGATCCCGGTATTGTGCCACAA
CTTCAGAACATCGTGTCCACGGTTAATCTGTGCTGCAAACTGGACCTCAA
GAAAATAGCATTGCATGCGAGAAACGCCGAGTACAATCCTAAGCGATTTG
CGGCTGTGATTATGCGAATCCGAGAGCCCCGGACCACCGCCCTTATTTTC
AGCTCCGGCAAGATGGTGTGCACAGGGGCAAAGAGTGAGGACGACTCCAG
ACTGGCAGCGAGAAAGTATGCGCGCATCATCCAAAAGCTCGGTTTCCCTG
CAAAGTTCCTCGACTTTTAGATTCAAAACATGGTCGGCTCCTGCGATGTC
AAGTTCCCCATACGCTTGGGAGGCCTGGTGCTGACCCA

BO01082.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG9874-PA 1062 Tbp-RA 1..872 17..888 4310 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-RA 1387 CG9874-RA 191..1062 17..888 4330 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21686669..21687452 800..17 3920 100 Minus
2R 25286936 2R 21686517..21686605 888..800 415 97.8 Minus
Blast to na_te.dros performed 2015-02-13 16:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6870 175..324 133 57.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6932 176..329 129 59 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2348..2483 175..325 127 58.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6748..6898 175..325 126 58.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2494..2536 294..336 116 74.4 Plus
roo 9092 roo DM_ROO 9092bp 1084..1113 175..204 114 86.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6802..6825 175..198 111 95.8 Plus

BO01082.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:49 Download gff for BO01082.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9874-PA 1..871 17..887 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:16:49 Download gff for BO01082.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9874-PA 1..871 17..887 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:56:28 Download gff for BO01082.5prime
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 182..1061 7..887 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:36:08 Download gff for BO01082.5prime
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 182..1061 7..887 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:36:08 Download gff for BO01082.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 21686670..21687461 7..799 99   Minus
2R 21686518..21686605 800..887 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:56:28 Download gff for BO01082.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17574175..17574966 7..799 99   Minus
arm_2R 17574023..17574110 800..887 97 <- Minus

BO01082.complete Sequence

1093 bp (1093 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629415

> BO01082.complete
GAAGTTATCAGTCGACATGGACCAAATGCTAAGCCCCAACTTCTCGATTC
CGAGCATCGGAACGCCGCTCCACCAGATGGAAGCGGACCAGCAGATAGTG
GCCAATCCTGTGTACCATCCTCCGGCTGTATCGCAGCCGGATTCGTTGAT
GCCGGCACCCGGTTCCAGTTCCGTGCAGCACCAGCAGCAGCAACAGCAGT
CGGACGCCAGTGGGGGATCAGGTCTCTTTGGCCACGAACCATCGCTCCCG
CTGGCGCACAAACAAATGCAGAGTTACCAGCCATCGGCCTCCTATCAGCA
GCAGCAGCAGCAACAGCAGCTCCAGAGTCAGGCGCCCGGCGGCGGTGGGA
GCACTCCGCAGTCCATGATGCAGCCGCAGACGCCGCAGAGCATGATGGCC
CACATGATGCCCATGAGTGAGCGGAGTGTGGGCGGTTCGGGGGCCGGAGG
TGGCGGAGATGCCCTGAGCAACATCCACCAGACGATGGGCCCCTCCACGC
CGATGACACCAGCCACACCAGGTTCCGCTGATCCCGGTATTGTGCCACAA
CTTCAGAACATCGTGTCCACGGTTAATCTGTGCTGCAAACTGGACCTCAA
GAAAATAGCATTGCATGCGAGAAACGCCGAGTACAATCCTAAGCGATTTG
CGGCTGTGATTATGCGAATCCGAGAGCCCCGGACCACCGCCCTTATTTTC
AGCTCCGGCAAGATGGTGTGCACAGGGGCAAAGAGTGAGGACGACTCCAG
ACTGGCAGCGAGAAAGTATGCGCGCATCATCCAAAAGCTCGGTTTCCCTG
CAAAGTTCCTCGACTTTAAGATTCAAAACATGGTCGGCTCCTGCGATGTC
AAGTTCCCCATACGCTTGGAAGGCCTGGTGCTGACCCATTGCAACTTCAG
CAGCTACGAGCCTGAGCTATTTCCCGGCTTAATCTATCGTATGGTGCGAC
CTCGAATCGTGCTCCTCATCTTCGTGTCCGGAAAGGTGGTGCTCACTGGA
GCAAAGGTGCGGCAGGAGATCTACGATGCCTTCGACAAGATATTCCCCAT
TTTAAAGAAGTTCAAGAAGCAGTCAGCAAGCTTTCTAGACCAT

BO01082.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-RA 1062 CG9874-PA 1..1059 17..1075 5295 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-RA 1387 CG9874-RA 191..1249 17..1075 5295 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21686669..21687452 800..17 3920 100 Minus
2R 25286936 2R 21686330..21686605 1075..800 1380 100 Minus
Blast to na_te.dros performed 2014-11-27 14:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6870 175..324 133 57.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6932 176..329 129 59 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2348..2483 175..325 127 58.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6748..6898 175..325 126 58.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2494..2536 294..336 116 74.4 Plus
roo 9092 roo DM_ROO 9092bp 1084..1113 175..204 114 86.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6802..6825 175..198 111 95.8 Plus

BO01082.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:31 Download gff for BO01082.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 1..1062 17..1079 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:31 Download gff for BO01082.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 180..1250 7..1079 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:31 Download gff for BO01082.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 191..1249 17..1077 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:32 Download gff for BO01082.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 180..1250 7..1079 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:18:23 Download gff for BO01082.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-RA 191..1249 17..1077 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:18:23 Download gff for BO01082.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21686670..21687452 17..799 100   Minus
2R 21686328..21686605 800..1077 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:31 Download gff for BO01082.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17574175..17574957 17..799 100   Minus
arm_2R 17573833..17574110 800..1077 99 <- Minus

BO01082.pep Sequence

Translation from 16 to 1093

> BO01082.pep
MDQMLSPNFSIPSIGTPLHQMEADQQIVANPVYHPPAVSQPDSLMPAPGS
SSVQHQQQQQQSDASGGSGLFGHEPSLPLAHKQMQSYQPSASYQQQQQQQ
QLQSQAPGGGGSTPQSMMQPQTPQSMMAHMMPMSERSVGGSGAGGGGDAL
SNIHQTMGPSTPMTPATPGSADPGIVPQLQNIVSTVNLCCKLDLKKIALH
ARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARK
YARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPE
LFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFK
KQSASFLDH

BO01082.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Tbp-PA 353 CG9874-PA 1..353 1..353 1828 100 Plus
Trf-PA 224 CG7562-PA 22..223 148..351 586 55.9 Plus
Trf2-PJ 632 CG18009-PJ 204..385 179..359 355 41.8 Plus
Trf2-PH 632 CG18009-PH 204..385 179..359 355 41.8 Plus
Trf2-PI 1714 CG18009-PI 1286..1467 179..359 355 41.8 Plus