Clone BO01084 Report

Search the DGRC for BO01084

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptCG17912-RA
Protein status:BO01084.pep: full length peptide match
Sequenced Size:1105

Clone Sequence Records

BO01084.3prime Sequence

929 bp (756 high quality bases) assembled on 2005-11-30

> BO01084.3prime
ATGGTCTAGAAAGCTTGCTTTATATTGACTATGGTTTCTATAACTATGAT
AAGAACTCACTTCCTGGGCCTTCGACATGGCTGCGGAGACGACAATCGAG
TTAGCCATGCCACTGCTGCTATTGCTACCCGTGGGCGAGATCCCGGCCAG
CGACGGGGGCGGCGGAGTGGTGGGAATCGACGTAGAGGGGCCACCATTGT
TGCTGGGACTCTTGCGACTTTGTGGATTCGCCAGTGAAGCCAAAGCGGCC
GCCAACCGTGCTTGTATTTTCGGTTGGCGCGCGCGCAATTCTTCCAGACT
CAGGTCCTCCTGTGGATGCATAATCTTTGTGGTCACAGCAGCAGCGGAAG
TTCCGCTTGCCGCCGGTGGAGCTGGAGGTCGCTGCTGGTGTTGCTGAGCA
TCTGGCGGACCACTTGGTGGTGCGCTGGATGCGCCACCAGCATGATTGGT
GGTAGGCGGAGCACTTATGGTAGCATTACTGTACGCTGGAAATGTTGGCT
TTTGTTGAGCCATGGCGGCGGCGTGGTGATGATGGGCCGCCGCCGCAGCA
GCTGCCGCCGATGTTGTGGCCATGGCGGCTGGAAACAAAGGACGCGGAGG
CATCATGTGCGGCATCATGGGCACTGGATACGGAGGCAGTGGCGGCATGT
GCTGCATCATGCCCATGCCGTACTGCCCCAGCATGTGCGGTGGCATCATG
TTCGGGGGCATCATCATAGGCGGCGGTACACTCATGGCATATTCTACTTT
CTTTTTGGCCACCGGTTCATCATCGTCCGAATCAGACTTGCCACCATTCT
TCTGACGTTCGTGATCCCTGAGATCCTCGGCGGGAATGCCGTCCATGCCA
AAGATTTCGACTTTCAATATTGAGCGATTGGGCAGCGAGTGGGGGACCTT
GTCCACCCGTTTCCTGGTGCACCTGCATG

BO01084.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-PA 1074 CG17912-RA 227..1071 863..19 4225 100 Minus
CG17912-PA 1074 CG17912-RA 183..220 907..870 165 97.3 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-RA 1612 CG17912-RA 287..1196 929..19 4455 99.5 Minus
CG17912-RD 6091 CG17912-RD 287..1154 929..61 4245 99.4 Minus
CG17912-RC 4400 CG17912-RC 287..1154 929..61 4245 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16744688..16745149 480..19 2310 100 Minus
2L 23513712 2L 16744124..16744385 740..479 1310 100 Minus
2L 23513712 2L 16743880..16744067 929..741 790 95.8 Minus
Blast to na_te.dros performed on 2015-02-12 05:43:11 has no hits.

BO01084.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:52 Download gff for BO01084.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17912-PA 162..1074 15..929 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:16:53 Download gff for BO01084.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17912-PA 162..1074 15..929 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:17:08 Download gff for BO01084.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 287..1199 15..929 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:43:52 Download gff for BO01084.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 287..1199 15..929 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:43:52 Download gff for BO01084.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 16744690..16745152 15..478 99   Minus
2L 16744124..16744385 479..740 100 -> Minus
2L 16743880..16744067 741..929 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:17:08 Download gff for BO01084.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16744690..16745152 15..478 99   Minus
arm_2L 16744124..16744385 479..740 100 -> Minus
arm_2L 16743880..16744067 741..929 97 -> Minus

BO01084.5prime Sequence

838 bp (771 high quality bases) assembled on 2005-11-30

> BO01084.5prime
GAAGTTATCAGTCGACATGGGACGCAAGAAGAAGAAGGCCTCCAAACCCT
GGTGCTGGTACTGCAACCGTGAGTTCGATGACGAAAAGATCCTTGTGCAG
CACCAGAAGGCCAAGCACTTCAAATGCCACATCTGCCACAAGAAGTTGTA
CACCGGACCCGGACTATCCATACACTGCATGCAGGTGCACAAGGAAACGG
TGGACAAGGTCCCCAACTCGCTGCCCAATCGCTCAAATATTGAAGTCGAA
ATCTTTGGCATGGACGGCATTCCCGCCGAGGATCTCAGGGATCACGAACG
TCAGAAGAATGGTGGCAAGTCTGATTCGGACGATGATGAACCGGTGGCCA
AAAAGAAAGTAGAATATGCCATGAGTGTACCGCCGCCTATGATGATGCCC
CCGAACATGATGCCACCGCACATGCTGGGGCAGTACGGCATGGGCATGAT
GCAGCACATGCCGCCACTGCCTCCGTATCCAGTGCCCATGATGCCGCACA
TGATGCCTCCGCGTCCTTTGTTTCCAGCCGCCATGGCCACAACATCGGCG
GCAGCTGCTGCGGCGGCGGCCCATCATCACCACGCCGCCGCCATGGCTCA
ACAAAAGCCAACATTTCCAGCGTACAGTAATGCTACCATAAGTGCTCCGC
CTACCACCAATCATGCTGGTGGCGCATCCAGCGCACCACCAAGTGGTCCG
CCAGATGCTCAGCAACACCAGCAGCGACCTCCAGCTCCACCGGCGGCAAG
CGGAACTTCCGCTGCTGCTGTGACCCACAAGATTATGCATCCACAGGAGG
ACCTGAGTCTGGAAGAATTGCGCGCGCGCCAACCGAAA

BO01084.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-PA 1074 CG17912-RA 1..759 17..775 3795 100 Plus
CG17912-PA 1074 CG17912-RA 763..822 779..838 300 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-RD 6091 CG17912-RD 125..947 16..838 4070 99.8 Plus
CG17912-RC 4400 CG17912-RC 125..947 16..838 4070 99.8 Plus
CG17912-RG 3709 CG17912-RG 125..947 16..838 4070 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16743759..16744067 57..365 1545 100 Plus
2L 23513712 2L 16744124..16744385 366..627 1310 100 Plus
2L 23513712 2L 16744688..16744900 626..838 1020 98.6 Plus
2L 23513712 2L 16743529..16743573 16..60 225 100 Plus
Blast to na_te.dros performed on 2015-02-12 10:09:33 has no hits.

BO01084.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:52 Download gff for BO01084.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17912-PA 1..819 17..835 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:16:55 Download gff for BO01084.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17912-PA 1..819 17..835 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:47:15 Download gff for BO01084.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17912-RG 120..944 10..835 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:09:29 Download gff for BO01084.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17912-RG 120..944 10..835 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:09:29 Download gff for BO01084.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 16744690..16744897 628..835 99   Plus
2L 16744124..16744385 366..627 100 -> Plus
2L 16743760..16744067 58..365 100 -> Plus
2L 16743524..16743570 10..57 93 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:47:15 Download gff for BO01084.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16744690..16744897 628..835 99   Plus
arm_2L 16744124..16744385 366..627 100 -> Plus
arm_2L 16743760..16744067 58..365 100 -> Plus
arm_2L 16743524..16743570 10..57 93 -> Plus

BO01084.complete Sequence

1105 bp (1105 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629416

> BO01084.complete
GAAGTTATCAGTCGACATGGGACGCAAGAAGAAGAAGGCCTCCAAACCCT
GGTGCTGGTACTGCAACCGTGAGTTCGATGACGAAAAGATCCTTGTGCAG
CACCAGAAGGCCAAGCACTTCAAATGCCACATCTGCCACAAGAAGTTGTA
CACCGGACCCGGACTATCCATACACTGCATGCAGGTGCACAAGGAAACGG
TGGACAAGGTCCCCAACTCGCTGCCCAATCGCTCAAATATTGAAGTCGAA
ATCTTTGGCATGGACGGCATTCCCGCCGAGGATCTCAGGGATCACGAACG
TCAGAAGAATGGTGGCAAGTCTGATTCGGACGATGATGAACCGGTGGCCA
AAAAGAAAGTAGAATATGCCATGAGTGTACCGCCGCCTATGATGATGCCC
CCGAACATGATGCCACCGCACATGCTGGGGCAGTACGGCATGGGCATGAT
GCAGCACATGCCGCCACTGCCTCCGTATCCAGTGCCCATGATGCCGCACA
TGATGCCTCCGCGTCCTTTGTTTCCAGCCGCCATGGCCACAACATCGGCG
GCAGCTGCTGCGGCGGCGGCCCATCATCACCACGCCGCCGCCATGGCTCA
ACAAAAGCCAACATTTCCAGCGTACAGTAATGCTACCATAAGTGCTCCGC
CTACCACCAATCATGCTGGTGGCGCATCCAGCGCACCACCAAGTGGTCCG
CCAGATGCTCAGCAACACCAGCAGCGACCTCCAGCTCCACCGGCGGCAAG
CGGAACTTCCGCTGCTGCTGTGACCACAAAGATTATGCATCCACAGGAGG
ACCTGAGTCTGGAAGAATTGCGCGCGCGCCAACCGAAAATACAAGCACGG
TTGGCGGCCGCTTTGGCTTCACTGGCGAATCCACAAAGTCGCAAGAGTCC
CAGCAACAATGGTGGCCCCTCTACGTCGATTCCCACCACTCCGCCGCCCC
CGTCGCTGGCCGGGATCTCGCCCACGGGTAGCAATAGCAGCAGTGGCATG
GCTAACTCGATTGTCGTCTCCGCAGCCATGTCGAAGGCCCAGGAAGTGAG
TTCTTATCATAGTTATAGAAACCATAGTCAATATAAAGCAAGCTTTCTAG
ACCAT

BO01084.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-RA 1074 CG17912-PA 1..1071 17..1087 5355 100 Plus
CG17912-RD 1689 CG17912-PD 1..1029 17..1045 5145 100 Plus
CG17912-RC 1689 CG17912-PC 1..1029 17..1045 5145 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-RA 1612 CG17912-RA 125..1196 16..1087 5360 100 Plus
CG17912-RD 6091 CG17912-RD 125..1154 16..1045 5150 100 Plus
CG17912-RC 4400 CG17912-RC 125..1154 16..1045 5150 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16744688..16745149 626..1087 2310 100 Plus
2L 23513712 2L 16743759..16744067 57..365 1545 100 Plus
2L 23513712 2L 16744124..16744385 366..627 1310 100 Plus
2L 23513712 2L 16743529..16743573 16..60 225 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:34:43 has no hits.

BO01084.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:16 Download gff for BO01084.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 1..1074 17..1091 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:13 Download gff for BO01084.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 121..1200 10..1091 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:54 Download gff for BO01084.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 126..1196 17..1089 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:16 Download gff for BO01084.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 121..1200 10..1091 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:14:36 Download gff for BO01084.complete
Subject Subject Range Query Range Percent Splice Strand
CG17912-RA 126..1196 17..1089 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:14:36 Download gff for BO01084.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16744690..16745149 628..1089 99   Plus
2L 16744124..16744385 366..627 100 -> Plus
2L 16743760..16744067 58..365 100 -> Plus
2L 16743530..16743570 17..57 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:54 Download gff for BO01084.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16744690..16745149 628..1089 99   Plus
arm_2L 16744124..16744385 366..627 100 -> Plus
arm_2L 16743760..16744067 58..365 100 -> Plus
arm_2L 16743530..16743570 17..57 100 -> Plus

BO01084.pep Sequence

Translation from 16 to 1105

> BO01084.pep
MGRKKKKASKPWCWYCNREFDDEKILVQHQKAKHFKCHICHKKLYTGPGL
SIHCMQVHKETVDKVPNSLPNRSNIEVEIFGMDGIPAEDLRDHERQKNGG
KSDSDDDEPVAKKKVEYAMSVPPPMMMPPNMMPPHMLGQYGMGMMQHMPP
LPPYPVPMMPHMMPPRPLFPAAMATTSAAAAAAAAHHHHAAAMAQQKPTF
PAYSNATISAPPTTNHAGGASSAPPSGPPDAQQHQQRPPAPPAASGTSAA
AVTTKIMHPQEDLSLEELRARQPKIQARLAAALASLANPQSRKSPSNNGG
PSTSIPTTPPPPSLAGISPTGSNSSSGMANSIVVSAAMSKAQEVSSYHSY
RNHSQYKASFLDH

BO01084.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17912-PA 357 CG17912-PA 1..357 1..357 1916 100 Plus
CG17912-PG 476 CG17912-PG 1..343 1..343 1838 100 Plus
CG17912-PD 562 CG17912-PD 1..343 1..343 1838 100 Plus
CG17912-PC 562 CG17912-PC 1..343 1..343 1838 100 Plus
CG17912-PB 562 CG17912-PB 1..343 1..343 1838 100 Plus