Clone BO01087 Report

Search the DGRC for BO01087

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptSnr1-RA
Protein status:BO01087.pep:
Sequenced Size:1144

Clone Sequence Records

BO01087.3prime Sequence

761 bp (654 high quality bases) assembled on 2005-11-30

> BO01087.3prime
ATGGTCTAGAAAGCTTGCCCAACCAGTTGTGGTATTGGCCAGTCGTCGCA
TTCTGCGCGTGTTGCGGTCCTGGTCGCGGATTTTCTTCTCCATTTCGGCG
TCGGTAAGCGTCTCTAGGAATGGCGCCCATGCGTCAGCGTCGCTGGGATT
CCGGAAGGGCACATCAATCGTTGATAGAGGGGCCTCGCTGAAGGCGTACG
TTCGACAGTGCCACGATAGCTGACCCCTAATGCTGTAGGCAATGGCCGTA
ACAAACTCTCCTCCCAATCCCAATTCCGCACAGAGTTTAATGGCAAACTC
CTCGGGGTTGTTGTTCTTCTCGGACATGTCCCACTCGACCTGGTCGACGA
GCGAGGTGTTGCCCACGTGAATGTTCAGCTTAACAATGACCCGCTGGTCG
CAGGTCTCCTCGAGGATGGGGGGATCGTTGGGAAAGGCTTCGATCTGCTG
TCGGATGGCCTGTGCAATAGCCGGCACAAAGGGCAGGGGATTGAGGTCCA
GGTCGTCGCACAGCACCTCGGCAAACTGCTCCGGAGTAATCATGCTCTCG
TTCTTGTTCCACGTGAAGGTGTCGCGCAGCTTTTGACCCTCTAGCTCCAT
GTCCAGTCGAATGGGCACCAGGCACTCCTTCTGCGCCGCATTCTCCAGGC
TAGCCGTGGGATCCGTGTCGTCGAAACACATCGGGAATGTGCGAACCTTC
TTCGTGTGCACTCGGTTTCGGTTGATTGGCGTGGCCTGTGGCACTGCGTC
CAGNTGGCTGG

BO01087.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG1064-PA 1113 Snr1-RA 368..1110 761..19 3696 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-RA 1335 CG1064-RA 501..1243 761..19 3704 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5471920..5472662 761..19 3704 99.9 Minus
Blast to na_te.dros performed on 2015-02-12 05:43:23 has no hits.

BO01087.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:57 Download gff for BO01087.3prime
Subject Subject Range Query Range Percent Splice Strand
Snr1-PA 368..1113 16..761 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:01 Download gff for BO01087.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1064-PA 368..1113 16..761 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:17:11 Download gff for BO01087.3prime
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 501..1250 11..761 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:44:18 Download gff for BO01087.3prime
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 501..1250 11..761 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:44:18 Download gff for BO01087.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 5471920..5472669 11..761 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:17:11 Download gff for BO01087.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1297642..1298391 11..761 99   Minus

BO01087.5prime Sequence

649 bp (648 high quality bases) assembled on 2005-11-29

> BO01087.5prime
GAAGTTATCAGTCGACATGGCACTGCAGACATACGGGGACAAGCCGGTGG
CCTTCCAGCTGGAGGAGGGCGGCGAGTACTACTACGTGGGCTCGGAAGTG
GGCAACTACATGCGCCACTTCCGCGGCATTCTGTACAAGAAGTACCCGGG
AATGACCCGCATCGTCCTGTCCAACGAGGAGCGCAAGCGGCTGGCTGAGT
CCGGCCTCAGCTCCCACATCTTAGCCAGCTCTGTATCGCTGCTCCGCGCC
GTAGAGGTGGATGATATCATGGCCGGCAACGATGAAAAGTATCGCGCCGT
CTCCGTGAACACTTCCGATACGCCAGTGCCGCGGGAGAGCAAGTCAAAGA
AGCAGCCACAGTATGTGCCCACGATGCCGAACTCCAGCCACCTGGACGCA
GTGCCACAGGCCACGCCAATCAACCGAAACCGAGTGCACACGAAGAAGGT
TCGCACATTCCCGATGTGTTTCGACGACACGGATCCCACGGCTAGCCTGG
AGAATGCGGCGCAGAAGGAGTGCCTGGTGCCCATTCGACTGGACATGGAG
CTAGAGGGTCAAAAGCTGCGCGACACCTTCACGTGGAACAAGAACGAGAG
CATGATTACTCCGGAGCAGTTTGCCGAGGTGCTGTGCGACGACCTGGAC

BO01087.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG1064-PA 1113 Snr1-RA 1..633 17..649 3165 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-RA 1335 CG1064-RA 132..766 15..649 3175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5471825..5472185 289..649 1805 100 Plus
3R 32079331 3R 5471057..5471333 15..291 1385 100 Plus
Blast to na_te.dros performed on 2015-02-10 15:17:08 has no hits.

BO01087.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:22:58 Download gff for BO01087.5prime
Subject Subject Range Query Range Percent Splice Strand
Snr1-PA 1..633 17..649 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:02 Download gff for BO01087.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1064-PA 1..633 17..649 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:33:05 Download gff for BO01087.5prime
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 124..766 6..649 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:13:53 Download gff for BO01087.5prime
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 124..766 6..649 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:13:53 Download gff for BO01087.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 5471825..5472185 289..649 100   Plus
3R 5471049..5471330 6..288 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:33:05 Download gff for BO01087.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1297547..1297907 289..649 100   Plus
arm_3R 1296771..1297052 6..288 98 -> Plus

BO01087.complete Sequence

1144 bp (1144 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629417

> BO01087.complete
GAAGTTATCAGTCGACATGGCACTGCAGACATACGGGGACAAGCCGGTGG
CCTTCCAGCTGGAGGAGGGCGGCGAGTACTACTACGTGGGCTCGGAAGTG
GGCAACTACATGCGCCACTTCCGCGGCATTCTGTACAAGAAGTACCCGGG
AATGACCCGCATCGTCCTGTCCAACGAGGAGCGCAAGCGGCTGGCTGAGT
CCGGCCTCAGCTCCCACATCTTAGCCAGCTCTGTATCGCTGCTCCGCGCC
GTAGAGGTGGATGATATCATGGCCGGCAACGATGAAAAGTATCGCGCCGT
CTCCGTGAACACTTCCGATACGCCAGTGCCGCGGGAGAGCAAGTCAAAGA
AGCAGCCACAGTATGTGCCCACGATGCCGAACTCCAGCCACCTGGACGCA
GTGCCACAGGCCACGCCAATCAACCGAAACCGAGTGCACACGAAGAAGGT
TCGCACATTCCCGATGTGTTTCGACGACACGGATCCCACGGCTAGCCTGG
AGAATGCGGCGCAGAAGGAGTGCCTGGTGCCCATTCGACTGGACATGGAG
CTAGAGGGTCAAAAGCTGCGCGACACCTTCACGTGGAACAAGAACGAGAG
CATGATTACTCCGGAGCAGTTTGCCGAGGTGCTGTGCGACGACCTGGACC
TCAATCCCCTGCCCTTTGTGCCGGCTATTGCACAGGCCATCCGACAGCAG
ATCGAAGCCTTTCCCAACGATCCCCCCATCCTCGAGGAGACCTGCGACCA
GCGGGTCATTGTTAAGCTGAACATTCACGTGGGCAACACCTCGCTCGTCG
ACCAGGTCGAGTGGGACATGTCCGAGAAGAACAACAACCCCGAGGAGTTT
GCCATTAAACTCTGTGCGGAATTGGGATTGGGAGGAGAGTTTGTTACGGC
CATTGCCTACAGCATTAGGGGTCAGCTATCGTGGCACTGTCGAACGTACG
CCTTCAGCGAGGCCCCTCTATCAACGATTGATGTGCCCTTCCGGAATCCC
AGCGACGCTGACGCATGGGCGCCATTCCTAGAGACGCTTACCGACGCCGA
AATGGAGAAGAAAATCCGCGACCAGGACCGCAACACGCGCAGAATGCGAC
GACTGGCCAATACCACAACTGGTTGGGCAAGCTTTCTAGACCAT

BO01087.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-RA 1113 CG1064-PA 1..1110 17..1126 5550 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-RA 1335 CG1064-RA 132..1243 15..1126 5560 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5471825..5472662 289..1126 4190 100 Plus
3R 32079331 3R 5471057..5471333 15..291 1385 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:11:30 has no hits.

BO01087.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:17 Download gff for BO01087.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 1..1113 17..1129 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:15 Download gff for BO01087.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 133..1259 6..1134 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:54:28 Download gff for BO01087.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 134..1243 17..1128 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:18 Download gff for BO01087.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 133..1259 6..1134 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:13 Download gff for BO01087.complete
Subject Subject Range Query Range Percent Splice Strand
Snr1-RA 134..1243 17..1128 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:13:13 Download gff for BO01087.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5471825..5472662 289..1128 99   Plus
3R 5471059..5471330 17..288 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:54:28 Download gff for BO01087.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1297547..1298384 289..1128 99   Plus
arm_3R 1296781..1297052 17..288 100 -> Plus

BO01087.pep Sequence

Translation from 16 to 1144

> BO01087.pep
MALQTYGDKPVAFQLEEGGEYYYVGSEVGNYMRHFRGILYKKYPGMTRIV
LSNEERKRLAESGLSSHILASSVSLLRAVEVDDIMAGNDEKYRAVSVNTS
DTPVPRESKSKKQPQYVPTMPNSSHLDAVPQATPINRNRVHTKKVRTFPM
CFDDTDPTASLENAAQKECLVPIRLDMELEGQKLRDTFTWNKNESMITPE
QFAEVLCDDLDLNPLPFVPAIAQAIRQQIEAFPNDPPILEETCDQRVIVK
LNIHVGNTSLVDQVEWDMSEKNNNPEEFAIKLCAELGLGGEFVTAIAYSI
RGQLSWHCRTYAFSEAPLSTIDVPFRNPSDADAWAPFLETLTDAEMEKKI
RDQDRNTRRMRRLANTTTGWASFLDH

BO01087.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Snr1-PA 370 CG1064-PA 1..370 1..370 1942 100 Plus