Clone BO01090 Report

Search the DGRC for BO01090

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptE2f2-RA
Protein status:BO01090.pep: full length peptide match
Sequenced Size:1144

Clone Sequence Records

BO01090.3prime Sequence

750 bp (749 high quality bases) assembled on 2005-11-30

> BO01090.3prime
ATGGTCTAGAAAGCTTGCGGAGCACTGAACATCAAACAGCTCGCAAATAC
CTTCGTCGCTTTTTAACGCAAAGTTGAAGTCTTCCTGCGGAGGATTCAGC
TGCAGCAGCGGCGGGTTTTCTAGATTCGGATCATCGGGATAAAATCGCCG
CAGCGAATGACCGGACAGATAATTTTGGAAGATTATCTTGGCCGTCAGCT
CGTTCTCCAAAAGTTTCATCTCATCTTTCATCCCGGGATTGCACGAGTAA
CCGTGCTCGTCGGTGATCACGTTCCCCGCGCATGCTGGAGCGTTACCATC
CTCGCTGGAGTGCGACGACGTCGAGGGTGAGGGCGTGTCCAGACGGTGAT
AGTCAAAGAACCCATCCACATCGTGCGGATTTGTAGTACTCTTTCCTTGG
TTCGTCACCAGGCGAATGTCAATTGCGCTGCCATTGTCCAGCGACACGGC
CAGCTCGTAATGATTACGCTTGATATCTACTTCCTCGTCATAATTAGGTA
TTGTGAATACGGAATCATCTCCAAAGATGTCCAGCAGATCATCACGTGTC
ACATATGCATACGACCTATTCGAGGGATCCTGCATAACGTAGCGCAGATT
GCGCTGTGCATACTCCAGTTGCCTGTCTAGGTCATCCTCCAACATTTTCA
AATGATTAGTCCGGCTACGTGCCAGGTCGTAGTTCTCTTGGTCCTTGGCA
TTGTTAAAGCCCCCTCCGCGCCAGCGCACTAGGGAGCAGTGTCTGCCCTT

BO01090.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG1071-PA 1113 E2f2-RA 379..1110 750..19 3660 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-RB 2002 CG1071-RB 1085..1816 750..19 3660 100 Minus
E2f2-RA 1485 CG1071-RA 568..1299 750..19 3660 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21154646..21154985 120..459 1700 100 Plus
2L 23513712 2L 21155107..21155366 460..719 1300 100 Plus
2L 23513712 2L 21154479..21154581 19..121 515 100 Plus
Blast to na_te.dros performed on 2015-02-11 04:17:32 has no hits.

BO01090.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:03 Download gff for BO01090.3prime
Subject Subject Range Query Range Percent Splice Strand
E2f2-PA 379..1113 15..750 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:08 Download gff for BO01090.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1071-PA 379..1113 15..750 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 05:00:29 Download gff for BO01090.3prime
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 568..1304 12..750 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:10:44 Download gff for BO01090.3prime
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 568..1304 12..750 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:10:44 Download gff for BO01090.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 21155572..21155603 719..750 100   Plus
2L 21155107..21155365 460..718 100 <- Plus
2L 21154646..21154985 120..459 100 <- Plus
2L 21154474..21154579 12..119 97 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 05:00:29 Download gff for BO01090.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21155572..21155603 719..750 100   Plus
arm_2L 21155107..21155365 460..718 100 <- Plus
arm_2L 21154646..21154985 120..459 100 <- Plus
arm_2L 21154474..21154579 12..119 97 <- Plus

BO01090.5prime Sequence

861 bp (760 high quality bases) assembled on 2005-11-29

> BO01090.5prime
GAAGTTATCAGTCGACATGTACAAGCGCAAAACCGCGAGTATTGTTAAAA
GAGACAGCTCCGCAGCGGGCACCACCTCCTCGGCTATGATGATGAAGGTG
GATTCGGCTGAGACTTCGGTCCGGTCGCAGAGCTACGAGTCTACACCCGT
TAGCATGGACACATCACCGGATCCTCCAACGCCAATCAAGTCTCCGTCGA
ATTCACAATCGCAATCGCAGCCTGGACAACAGCGCTCCGTGGGCTCACTG
GTCCTGCTCACACAGAAGTTTGTGGATCTCGTGAAGGCCAACGAAGGATC
CATCGACCTGAAAGCGGCAACCAAAATCTTGGACGTACAGAAGCGCCGAA
TATACGATATTACCAATGTTTTAGAGGGCATTGGACTAATTGATAAGGGC
AGACACTGCTCCCTAGTGCGCTGGCGCGGAGGGGGCTTTAACAATGCCAA
GGACCAAGAGAACTACGACCTGGCACGTAGCCGGACTAATCATTTGAAAA
TGTTGGAGGATGACCTAGACAGGCAACTGGAGTATGCACAGCGCAATCTG
CGCTACGTTATGCAGGATCCCTCGAATAGGTCGTATGCATATGTGACACG
TGATGATCTGCTGGACATCTTTGGAGATGATTCCGTATTCACAATACCTA
ATTATGACGAGGAAGTAGATATCAAGCGTAATCATTACGAGCTGGCCGTG
TCGCTGGACAATGGCAGCGCAATTGACATTCGCCTGGTGACGAAACCAAG
GAAGAGTACTACAAATCCGCACGATGTGGATGGGTTCTTTGACTATCACC
GTCTGGACACGCCCTCACCCTCGACGTCGTCGCACTCCAGCGAGGATGGT
AACGCTCCAGC

BO01090.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG1071-PA 1113 E2f2-RA 1..728 17..744 3640 100 Plus
CG1071-PA 1113 E2f2-RA 736..845 752..861 550 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-RB 2002 CG1071-RB 706..1551 16..861 4185 99.8 Plus
E2f2-RA 1485 CG1071-RA 189..1034 16..861 4185 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21155743..21156044 317..16 1510 100 Minus
2L 23513712 2L 21155107..21155366 685..426 1300 100 Minus
2L 23513712 2L 21154810..21154985 861..686 820 97.7 Minus
2L 23513712 2L 21155572..21155682 426..316 555 100 Minus
Blast to na_te.dros performed on 2015-02-13 00:59:50 has no hits.

BO01090.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:04 Download gff for BO01090.5prime
Subject Subject Range Query Range Percent Splice Strand
E2f2-PA 1..845 17..861 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:10 Download gff for BO01090.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1071-PA 1..845 17..861 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:28:23 Download gff for BO01090.5prime
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 189..1034 16..861 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:02:25 Download gff for BO01090.5prime
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 189..1034 16..861 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:02:25 Download gff for BO01090.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 21155744..21156044 16..316 100   Minus
2L 21155572..21155681 317..426 100 <- Minus
2L 21155107..21155365 427..685 100 <- Minus
2L 21154810..21154985 686..861 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:28:23 Download gff for BO01090.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21155744..21156044 16..316 100   Minus
arm_2L 21155572..21155681 317..426 100 <- Minus
arm_2L 21155107..21155365 427..685 100 <- Minus
arm_2L 21154810..21154985 686..861 98 <- Minus

BO01090.complete Sequence

1144 bp (1144 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629418

> BO01090.complete
GAAGTTATCAGTCGACATGTACAAGCGCAAAACCGCGAGTATTGTTAAAA
GAGACAGCTCCGCAGCGGGCACCACCTCCTCGGCTATGATGATGAAGGTG
GATTCGGCTGAGACTTCGGTCCGGTCGCAGAGCTACGAGTCTACACCCGT
TAGCATGGACACATCACCGGATCCTCCAACGCCAATCAAGTCTCCGTCGA
ATTCACAATCGCAATCGCAGCCTGGACAACAGCGCTCCGTGGGCTCACTG
GTCCTGCTCACACAGAAGTTTGTGGATCTCGTGAAGGCCAACGAAGGATC
CATCGACCTGAAAGCGGCAACCAAAATCTTGGACGTACAGAAGCGCCGAA
TATACGATATTACCAATGTTTTAGAGGGCATTGGACTAATTGATAAGGGC
AGACACTGCTCCCTAGTGCGCTGGCGCGGAGGGGGCTTTAACAATGCCAA
GGACCAAGAGAACTACGACCTGGCACGTAGCCGGACTAATCATTTGAAAA
TGTTGGAGGATGACCTAGACAGGCAACTGGAGTATGCACAGCGCAATCTG
CGCTACGTTATGCAGGATCCCTCGAATAGGTCGTATGCATATGTGACACG
TGATGATCTGCTGGACATCTTTGGAGATGATTCCGTATTCACAATACCTA
ATTATGACGAGGAAGTAGATATCAAGCGTAATCATTACGAGCTGGCCGTG
TCGCTGGACAATGGCAGCGCAATTGACATTCGCCTGGTGACGAACCAAGG
AAAGAGTACTACAAATCCGCACGATGTGGATGGGTTCTTTGACTATCACC
GTCTGGACACGCCCTCACCCTCGACGTCGTCGCACTCCAGCGAGGATGGT
AACGCTCCAGCATGCGCGGGGAACGTGATCACCGACGAGCACGGTTACTC
GTGCAATCCCGGGATGAAAGATGAGATGAAACTTTTGGAGAACGAGCTGA
CGGCCAAGATAATCTTCCAAAATTATCTGTCCGGTCATTCGCTGCGGCGA
TTTTATCCCGATGATCCGAATCTAGAAAACCCGCCGCTGCTGCAGCTGAA
TCCTCCGCAGGAAGACTTCAACTTTGCGTTAAAAAGCGACGAAGGTATTT
GCGAGCTGTTTGATGTTCAGTGCTCCGCAAGCTTTCTAGACCAT

BO01090.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-RB 1113 CG1071-PB 1..1110 17..1126 5550 100 Plus
E2f2-RA 1113 CG1071-PA 1..1110 17..1126 5550 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-RB 2002 CG1071-RB 706..1816 16..1126 5555 100 Plus
E2f2-RA 1485 CG1071-RA 189..1299 16..1126 5555 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21154646..21154985 1025..686 1700 100 Minus
2L 23513712 2L 21155743..21156044 317..16 1510 100 Minus
2L 23513712 2L 21155107..21155366 685..426 1300 100 Minus
2L 23513712 2L 21155572..21155682 426..316 555 100 Minus
2L 23513712 2L 21154479..21154581 1126..1024 515 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:33:32 has no hits.

BO01090.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:18 Download gff for BO01090.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 1..1113 17..1130 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:16 Download gff for BO01090.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 202..1317 16..1133 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:09:02 Download gff for BO01090.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 190..1299 17..1128 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:19 Download gff for BO01090.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 202..1317 16..1133 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:23:46 Download gff for BO01090.complete
Subject Subject Range Query Range Percent Splice Strand
E2f2-RA 190..1299 17..1128 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:23:46 Download gff for BO01090.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21155744..21156043 17..316 100   Minus
2L 21155572..21155681 317..426 100 <- Minus
2L 21155107..21155365 427..685 100 <- Minus
2L 21154646..21154985 686..1025 100 <- Minus
2L 21154477..21154579 1026..1128 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:09:02 Download gff for BO01090.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21155744..21156043 17..316 100   Minus
arm_2L 21155572..21155681 317..426 100 <- Minus
arm_2L 21155107..21155365 427..685 100 <- Minus
arm_2L 21154646..21154985 686..1025 100 <- Minus
arm_2L 21154477..21154579 1026..1128 98 <- Minus

BO01090.pep Sequence

Translation from 16 to 1144

> BO01090.pep
MYKRKTASIVKRDSSAAGTTSSAMMMKVDSAETSVRSQSYESTPVSMDTS
PDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLVKANEGSIDLKA
ATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWRGGGFNNAKDQENY
DLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLD
IFGDDSVFTIPNYDEEVDIKRNHYELAVSLDNGSAIDIRLVTNQGKSTTN
PHDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEHGYSCNPGM
KDEMKLLENELTAKIIFQNYLSGHSLRRFYPDDPNLENPPLLQLNPPQED
FNFALKSDEGICELFDVQCSASFLDH

BO01090.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
E2f2-PB 370 CG1071-PB 1..370 1..370 1931 100 Plus
E2f2-PA 370 CG1071-PA 1..370 1..370 1931 100 Plus
E2f1-PF 805 CG6376-PF 229..425 44..240 222 34.3 Plus
E2f1-PA 805 CG6376-PA 229..425 44..240 222 34.3 Plus
E2f1-PC 805 CG6376-PC 229..425 44..240 222 34.3 Plus