Clone BO01092 Report

Search the DGRC for BO01092

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptCG1792-RA
Protein status:BO01092.pep: full length peptide match
Sequenced Size:1150

Clone Sequence Records

BO01092.3prime Sequence

888 bp (786 high quality bases) assembled on 2005-11-30

> BO01092.3prime
ATGGTCTAGAAAGCTTGCAGATCCACTTTTTCCTAGTAAAGCCTCATCCT
TAGCCCCTGTCTGCATGCCGTTACTGGCCTTCACGTCCAGTTCCACAGGA
TTGTCCAGTGCCGCCTGGGCGCTTGAAGTGTGGGCGTGACCTTTTGAGCG
ATAGTGGGAGGTCAGGTGGGAGCGGCGAACGAAGGAGACTTGGCAGGAGT
CGCAGTGGAACGCTCGCACTCCGGTGTGACTCAGCATGTGCGTGCGGAGT
TTTCCGCTCATGGCAAAGCTTTTATTGCATTCCTTGCACGTGAAGGGCTT
GACATTCGTGTGGCGCATGCGTTCGTGCTGGATGCGTCCGCTGGCGTTGC
TGTAGGTTGCCTCGCAGTAGCGACACTGAAACAAAGCATTCCCCGCATGC
AGTTCTTGGTGGCGCCGCAGAAGCGTAGCAGTGTAGAACTGCTGGGAGCA
CTGGTCACAGGCAAAGCTCTTTACGCCGGTGTGTCGGAGGAGGTGCAACT
TGAAGTTGCTGGGGCAGGTGAAGTGCCGGCCACACTGCTCGCATATGCAA
TCCCGCTTGCGTCGCTCCCGCTTTAGGGCCACCACTTCGTCCTCGGTGAG
TCTGCTCCACTGGGTGCGCGTGGCCTGGCTATTGTCCGCAAACTTAACGG
AGGTAAAGACTGTGGGCGTGGTCTTTGTACTTCTGCGGAGCTTCTTCTCC
TGCGCAGGAACCTTCACTTGGGGCTGCTCGTTCTGCTCACATATTTCGTA
CGGCTCTTCCGTCTCTTCCAGCAGGTGTTCCTCGGGTAGAAGGTCTATAA
CCTCGATCTCGGTGACCTCTTCAGCGTACTGAATCTCCTTCTCCACACCA
ACTGCGAAGGAATCGATCAATTTCCGCGTTCCCCAGGT

BO01092.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-PA 1119 CG1792-RA 263..1116 872..19 4245 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-RA 1344 CG1792-RA 347..1215 888..19 4310 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31616702..31617273 888..316 2800 99.7 Minus
3R 32079331 3R 31617522..31617708 205..19 935 100 Minus
3R 32079331 3R 31617349..31617459 316..206 555 100 Minus
Blast to na_te.dros performed on 2015-02-13 13:17:28 has no hits.

BO01092.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:07 Download gff for BO01092.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1792-PA 248..1119 18..888 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:14 Download gff for BO01092.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1792-PA 248..1119 18..888 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:33:07 Download gff for BO01092.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 347..1215 19..888 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:36:04 Download gff for BO01092.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 347..1215 19..888 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:36:04 Download gff for BO01092.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 31617522..31617708 19..205 100   Minus
3R 31617349..31617459 206..316 100 -> Minus
3R 31616702..31617272 317..888 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:33:07 Download gff for BO01092.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27443244..27443430 19..205 100   Minus
arm_3R 27443071..27443181 206..316 100 -> Minus
arm_3R 27442424..27442994 317..888 99 -> Minus

BO01092.5prime Sequence

844 bp (763 high quality bases) assembled on 2005-11-30

> BO01092.5prime
GAAGTTATCAGTCGACATGCCGAATCGTAATTGCCGGACTTGCGGCCTGT
TCATTTTCTGTTCGACGCCCAGTAACCTCTTCGAGGAGCCCAATTCCGTA
ATGCTGCACCAGATCGAGGTTCTTACTGGTTTGTTTTTGCTCGGCGGACC
CGGGAACGAGCTGCCCCCCTTTATTTGCTCACCCTGCGAATTGGACCTGC
AGACGGCGATTGCTTTCCGGGAACGTGTGATTCGAACCCAAAAAACGCTG
CAGGAAAGTCCCAACCTGGGGAACGCGGAATTGATCGAATCCTTCGCAGT
TGGTGTGGAGAAGGAGATTCAGTACGCTGAAGAGGTCACCGAGATCGAGG
TTATAGACCTTCTACCCGAGGAACACCTGCTGGAAGAGACGGAAGAGCCG
TACGAAATATGTGAGCAGAACGAGCAGCCCCAAGTGAAGGTTCCTGCGCA
GGAGAAGAAGCTCCGCAGAAGTACAAAGACCACGCCCACAGTCTTTACCT
CCGTTAAGTTTGCGGACAATAGCCAGGCCACGCGCACCCAGTGGAGCAGA
CTCACCGAGGACGAAGTGGTGGCCCTAAAGCGGGAGCGACGCAAGCGGGA
TTGCATATGCGAGCAGTGTGGCCGGCACTTCACCTGCCCCAGCAACTTCA
AGTTGCACCTCCTCCGACACACCGGCGTAAAGAGCTTTGCCTGTGACCAG
TGCTCCCAGCAGTTCTACACTGCTACGCTTCTGCGGCGCCACCAAGAACT
GCATGCGGGGAATGCTTTGTTTCAGTGTCGCTACTGCGAGGCAACCTACA
GCAACGCCAGCGGACGCATCCAGCACGAACGCATGCGCCACACG

BO01092.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-PA 1119 CG1792-RA 1..828 17..844 4140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-RA 1344 CG1792-RA 100..927 17..844 4140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31616575..31617273 137..835 3495 100 Plus
3R 32079331 3R 31616402..31616521 17..136 600 100 Plus
Blast to na_te.dros performed on 2015-02-13 13:17:31 has no hits.

BO01092.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:08 Download gff for BO01092.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1792-PA 1..828 17..844 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:16 Download gff for BO01092.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1792-PA 1..828 17..844 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:33:09 Download gff for BO01092.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 100..927 17..844 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:36:17 Download gff for BO01092.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 100..927 17..844 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:36:17 Download gff for BO01092.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 31616575..31617281 137..844 99   Plus
3R 31616402..31616521 17..136 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:33:09 Download gff for BO01092.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27442297..27443003 137..844 99   Plus
arm_3R 27442124..27442243 17..136 100 -> Plus

BO01092.complete Sequence

1150 bp (1150 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629419

> BO01092.complete
GAAGTTATCAGTCGACATGCCGAATCGTAATTGCCGGACTTGCGGCCTGT
TCATTTTCTGTTCGACGCCCAGTAACCTCTTCGAGGAGCCCAATTCCGTA
ATGCTGCACCAGATCGAGGTTCTTACTGGTTTGTTTTTGCTCGGCGGACC
CGGGAACGAGCTGCCCCCCTTTATTTGCTCACCCTGCGAATTGGACCTGC
AGACGGCGATTGCTTTCCGGGAACGTGTGATTCGAACCCAAAAAACGCTG
CAGGAAAGTCCCAACCTGGGGAACGCGGAATTGATCGAATCCTTCGCAGT
TGGTGTGGAGAAGGAGATTCAGTACGCTGAAGAGGTCACCGAGATCGAGG
TTATAGACCTTCTACCCGAGGAACACCTGCTGGAAGAGACGGAAGAGCCG
TACGAAATATGTGAGCAGAACGAGCAGCCCCAAGTGAAGGTTCCTGCGCA
GGAGAAGAAGCTCCGCAGAAGTACAAAGACCACGCCCACAGTCTTTACCT
CCGTTAAGTTTGCGGACAATAGCCAGGCCACGCGCACCCAGTGGAGCAGA
CTCACCGAGGACGAAGTGGTGGCCCTAAAGCGGGAGCGACGCAAGCGGGA
TTGCATATGCGAGCAGTGTGGCCGGCACTTCACCTGCCCCAGCAACTTCA
AGTTGCACCTCCTCCGACACACCGGCGTAAAGAGCTTTGCCTGTGACCAG
TGCTCCCAGCAGTTCTACACTGCTACGCTTCTGCGGCGCCACCAAGAACT
GCATGCGGGGAATGCTTTGTTTCAGTGTCGCTACTGCGAGGCAACCTACA
GCAACGCCAGCGGACGCATCCAGCACGAACGCATGCGCCACACGAATGTC
AAGCCCTTCACGTGCAAGGAATGCAATAAAAGCTTTGCCATGAGCGGAAA
ACTCCGCACGCACATGCTGAGTCACACCGGAGTGCGAGCGTTCCACTGCG
ACTCCTGCCAAGTCTCCTTCGTTCGCCGCTCCCACCTGACCTCCCACTAT
CGCTCAAAAGGTCACGCCCACACTTCAAGCGCCCAGGCGGCACTGGACAA
TCCTGTGGAACTGGACGTGAAGGCCAGTAACGGCATGCAGACAGGGGCTA
AGGATGAGGCTTTACTAGGAAAAAGTGGATCTGCAAGCTTTCTAGACCAT

BO01092.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-RA 1119 CG1792-PA 1..1116 17..1132 5580 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-RA 1344 CG1792-RA 100..1215 17..1132 5580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31616575..31617273 137..835 3495 100 Plus
3R 32079331 3R 31617522..31617708 946..1132 935 100 Plus
3R 32079331 3R 31616402..31616521 17..136 600 100 Plus
3R 32079331 3R 31617349..31617459 835..945 555 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:38:07 has no hits.

BO01092.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:20 Download gff for BO01092.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 1..1119 17..1133 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:18 Download gff for BO01092.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 63..1178 17..1132 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:57:35 Download gff for BO01092.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 100..1215 17..1134 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:20 Download gff for BO01092.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 63..1178 17..1132 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:23:09 Download gff for BO01092.complete
Subject Subject Range Query Range Percent Splice Strand
CG1792-RA 100..1215 17..1134 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:23:09 Download gff for BO01092.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31617522..31617708 946..1134 98   Plus
3R 31617349..31617459 835..945 100 -> Plus
3R 31616575..31617272 137..834 100 -> Plus
3R 31616402..31616521 17..136 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:57:35 Download gff for BO01092.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27443244..27443430 946..1134 98   Plus
arm_3R 27443071..27443181 835..945 100 -> Plus
arm_3R 27442297..27442994 137..834 100 -> Plus
arm_3R 27442124..27442243 17..136 100 -> Plus

BO01092.pep Sequence

Translation from 16 to 1150

> BO01092.pep
MPNRNCRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELP
PFICSPCELDLQTAIAFRERVIRTQKTLQESPNLGNAELIESFAVGVEKE
IQYAEEVTEIEVIDLLPEEHLLEETEEPYEICEQNEQPQVKVPAQEKKLR
RSTKTTPTVFTSVKFADNSQATRTQWSRLTEDEVVALKRERRKRDCICEQ
CGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELHAGNA
LFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHM
LSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNPVELD
VKASNGMQTGAKDEALLGKSGSASFLDH

BO01092.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG1792-PA 372 CG1792-PA 1..372 1..372 1974 100 Plus
ranshi-PA 346 CG9793-PA 1..346 1..346 485 34.7 Plus
CG8159-PB 399 CG8159-PB 6..349 6..354 476 34.2 Plus
CG18764-PA 409 CG18764-PA 159..395 90..333 476 39.1 Plus
CG11762-PA 312 CG11762-PA 1..310 1..340 421 29.5 Plus
CG18764-PA 409 CG18764-PA 5..340 6..334 203 26.2 Plus