Clone BO01096 Report

Search the DGRC for BO01096

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:10
Well:96
Vector:pDNR-Dual
Associated Gene/Transcriptsug-RA
Protein status:BO01096.pep:
Sequenced Size:1186

Clone Sequence Records

BO01096.3prime Sequence

927 bp (752 high quality bases) assembled on 2005-11-30

> BO01096.3prime
ATGGTCTAGAAAGCTTGCGATTCGATGGATGCGCAGGTCGAGCGGTGACT
CCACGTCCATCTTAACGAAGAAGTCCTCGCTGTGGAGATAGCTATGCTGT
CTATCGCCTAGCCAATAGCTGGGCGAGAATTCCGCATCCTGTTTGGGTTT
TAGCGAGTAATCGCTGGGCTCATTGTTGGAGTCATCGTAGTAGCGGGCGG
ATGAGGAGGAGCTGGTGGACTCCACACTGCTGGCAGCGGGAAGACACGTG
AACGCTGATTCGCTGCTGGCCTCCAGGAGACAGGGTACGCTGGGCAGAGT
GAGCGGCTGGCTGGCGATCAGGTGGATGCTGTGCTTGAAGGTCTTGACGT
GCTTTCGCAGCGAGGACGGATCCGTGTAGCGCTTCTGGCAGCCGGCCACT
TTGCACATGTACGGCTTCTCCATCGAATGGGTGCGCGTGTGCTTGAAACG
ATCCGAGGAGTTCGAGTACGCCTTCTGGCAGCCCTCGAAGCTGCACTTGT
AGGGTTTCTCGCCCGAGTGTGACCTAATGTGGATCTTCAGGTTCTCCGCC
CGCGAGAAGGACTTCTCGCACAGGTGACAGCGATGTGGCTTCTCCTTCGT
GTGGGTGCGGGTATGGACAAGCATCTTGTAGCGGGCATTGAATCCTCGCT
CGCTGCGCTGACATCCCCGCCAGCGGCAATAGTAGAGTCCGTCTGTCAGG
CTGGCGATCGCATGTCGCTGGGTCACGTGCTGTGCCAGTGCATCCAAGGT
GTCGAAAACTCTATCGCAATCTGTCCAGTTGCATACGAAATCGCTGGCGG
TGCCGCACTCGCTGCTGCTGCTGCAGGACTTGCTGTCGTCGGGGAACTCC
ACTGGACTGCGGCAGAGCTCGTCCTGCTGGCCACGAGCCTTCATGATCAC
GGACTGGGTGCGCTGACGATATCCGTA

BO01096.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG3850-PA 1155 sug-RA 244..1152 927..19 4545 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
sug-RB 1468 CG3850-RB 441..1349 927..19 4545 100 Minus
sug-RA 1343 CG3850-RA 316..1224 927..19 4545 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12929782..12930525 762..19 3720 100 Minus
2R 25286936 2R 12929175..12929341 927..761 835 100 Minus
Blast to na_te.dros performed on 2015-02-12 10:09:44 has no hits.

BO01096.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:12 Download gff for BO01096.3prime
Subject Subject Range Query Range Percent Splice Strand
sug-PA 245..1155 16..926 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:22 Download gff for BO01096.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3850-PA 245..1155 16..926 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:47:20 Download gff for BO01096.3prime
Subject Subject Range Query Range Percent Splice Strand
sug-RA 317..1230 12..926 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:09:49 Download gff for BO01096.3prime
Subject Subject Range Query Range Percent Splice Strand
sug-RA 317..1230 12..926 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:09:49 Download gff for BO01096.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12929784..12930531 12..760 99   Minus
2R 12929176..12929341 761..926 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:47:20 Download gff for BO01096.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8817289..8818036 12..760 99   Minus
arm_2R 8816681..8816846 761..926 100 -> Minus

BO01096.5prime Sequence

871 bp (860 high quality bases) assembled on 2005-11-30

> BO01096.5prime
GAAGTTATCAGTCGACATGGATATAATACAAAAGTCAATCTTCAACAGCG
GCCCACACAGCAGAGGCATCTACGAGCCGCCTCTCGGCTACTTTACGCCG
TATAACACACCACCGTACATAGCCGCCTACTCGGATTCCGGCAGCTGGTT
GGCGGATCACCACCAACACCACCAGCAGCAGCACCAGCAGCACCAGCAGC
AGATGCAGCACATCAGGTTTCCCACGCCGCCCATCACACCGCCGCGTCCC
ATCGCCGGATACGGATATCGTCAGCGCACCCAGTCCGTGATCATGAAGGC
TCGTGGCCAGCAGGACGAGCTCTGCCGCAGTCCAGTGGAGTTCCCCGACG
ACAGCAAGTCCTGCAGCAGCAGCAGCGAGTGCGGCACCGCCAGCGATTTC
GTATGCAACTGGACAGATTGCGATAGAGTTTTCGACACCTTGGATGCACT
GGCACAGCACGTGACCCAGCGACATGCGATCGCCAGCCTGACAGACGGAC
TCTACTATTGCCGCTGGCGGGGATGTCAGCGCAGCGAGCGAGGATTCAAT
GCCCGCTACAAGATGCTTGTCCATACCCGCACCCACACGAAGGAGAAGCC
ACATCGCTGTCACCTGTGCGAGAAGTCCTTCTCGCGGGCGGAGAACCTGA
AGATCCACATTAGGTCACACTCGGGCGAGAAACCCTACAAGTGCAGCTTC
GAGGGCTGCCAGAAGGCGTACTCGAACTCCTCGGATCGTTTCAAGCACAC
GCGCACCCATTCGATGGAGAAGCCGTACATGTGCAAAGTGGCCGGCTGCC
AGAAGCGCTACACGGATCCGTCCTCGCTGCGAAAGCACGTCAGGACCTTC
AAGCACAGCATCCACCTGATC

BO01096.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3850-PA 1155 sug-RA 1..855 17..871 4250 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
sug-RA 1343 CG3850-RA 71..927 15..871 4270 99.9 Plus
sug-RB 1468 CG3850-RB 228..1052 47..871 4110 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12929782..12930228 425..871 2220 99.8 Plus
2R 25286936 2R 12928930..12929341 15..426 2060 100 Plus
Blast to na_te.dros performed on 2015-02-12 10:09:51 has no hits.

BO01096.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:13 Download gff for BO01096.5prime
Subject Subject Range Query Range Percent Splice Strand
sug-PA 1..855 17..871 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:23 Download gff for BO01096.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3850-PA 1..855 17..871 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:47:21 Download gff for BO01096.5prime
Subject Subject Range Query Range Percent Splice Strand
sug-RA 65..927 9..871 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:10:03 Download gff for BO01096.5prime
Subject Subject Range Query Range Percent Splice Strand
sug-RA 65..927 9..871 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:10:03 Download gff for BO01096.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12929784..12930228 427..871 99   Plus
2R 12928924..12929341 9..426 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:47:21 Download gff for BO01096.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8817289..8817733 427..871 99   Plus
arm_2R 8816429..8816846 9..426 99 -> Plus

BO01096.complete Sequence

1186 bp (1186 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629420

> BO01096.complete
GAAGTTATCAGTCGACATGGATATAATACAAAAGTCAATCTTCAACAGCG
GCCCACACAGCAGAGGCATCTACGAGCCGCCTCTCGGCTACTTTACGCCG
TATAACACACCACCGTACATAGCCGCCTACTCGGATTCCGGCAGCTGGTT
GGCGGATCACCACCAACACCACCAGCAGCAGCACCAGCAGCACCAGCAGC
AGATGCAGCACATCAGGTTTCCCACGCCGCCCATCACACCGCCGCGTCCC
ATCGCCGGATACGGATATCGTCAGCGCACCCAGTCCGTGATCATGAAGGC
TCGTGGCCAGCAGGACGAGCTCTGCCGCAGTCCAGTGGAGTTCCCCGACG
ACAGCAAGTCCTGCAGCAGCAGCAGCGAGTGCGGCACCGCCAGCGATTTC
GTATGCAACTGGACAGATTGCGATAGAGTTTTCGACACCTTGGATGCACT
GGCACAGCACGTGACCCAGCGACATGCGATCGCCAGCCTGACAGACGGAC
TCTACTATTGCCGCTGGCGGGGATGTCAGCGCAGCGAGCGAGGATTCAAT
GCCCGCTACAAGATGCTTGTCCATACCCGCACCCACACGAAGGAGAAGCC
ACATCGCTGTCACCTGTGCGAGAAGTCCTTCTCGCGGGCGGAGAACCTGA
AGATCCACATTAGGTCACACTCGGGCGAGAAACCCTACAAGTGCAGCTTC
GAGGGCTGCCAGAAGGCGTACTCGAACTCCTCGGATCGTTTCAAGCACAC
GCGCACCCATTCGATGGAGAAGCCGTACATGTGCAAAGTGGCCGGCTGCC
AGAAGCGCTACACGGATCCGTCCTCGCTGCGAAAGCACGTCAAGACCTTC
AAGCACAGCATCCACCTGATCGCCAGCCAGCCGCTCACTCTGCCCAGCGT
ACCCTGTCTCCTGGAGGCCAGCAGCGAATCAGCGTTCACGTGTCTTCCCG
CTGCCAGCAGTGTGGAGTCCACCAGCTCCTCCTCATCCGCCCGCTACTAC
GATGACTCCAACAATGAGCCCAGCGATTACTCGCTAAAACCCAAACAGGA
TGCGGAATTCTCGCCCAGCTATTGGCTAGGCGATAGACAGCATAGCTATC
TCCACAGCGAGGACTTCTTCGTTAAGATGGACGTGGAGTCACCGCTCGAC
CTGCGCATCCATCGAATCGCAAGCTTTCTAGACCAT

BO01096.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
sug-RA 1155 CG3850-PA 1..1152 17..1168 5760 100 Plus
sug-RB 969 CG3850-PB 1..966 203..1168 4830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
sug-RA 1343 CG3850-RA 71..1224 15..1168 5770 100 Plus
sug-RB 1468 CG3850-RB 228..1349 47..1168 5610 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12929782..12930525 425..1168 3720 100 Plus
2R 25286936 2R 12928930..12929341 15..426 2060 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:45:47 has no hits.

BO01096.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:21 Download gff for BO01096.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 1..1155 17..1171 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:20 Download gff for BO01096.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 62..1227 9..1175 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:31:05 Download gff for BO01096.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 73..1224 17..1170 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:21 Download gff for BO01096.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 62..1227 9..1175 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:37:28 Download gff for BO01096.complete
Subject Subject Range Query Range Percent Splice Strand
sug-RA 73..1224 17..1170 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:37:28 Download gff for BO01096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12929784..12930525 427..1170 99   Plus
2R 12928932..12929341 17..426 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:31:05 Download gff for BO01096.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8817289..8818030 427..1170 99   Plus
arm_2R 8816437..8816846 17..426 100 -> Plus

BO01096.pep Sequence

Translation from 16 to 1186

> BO01096.pep
MDIIQKSIFNSGPHSRGIYEPPLGYFTPYNTPPYIAAYSDSGSWLADHHQ
HHQQQHQQHQQQMQHIRFPTPPITPPRPIAGYGYRQRTQSVIMKARGQQD
ELCRSPVEFPDDSKSCSSSSECGTASDFVCNWTDCDRVFDTLDALAQHVT
QRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHL
CEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSM
EKPYMCKVAGCQKRYTDPSSLRKHVKTFKHSIHLIASQPLTLPSVPCLLE
ASSESAFTCLPAASSVESTSSSSSARYYDDSNNEPSDYSLKPKQDAEFSP
SYWLGDRQHSYLHSEDFFVKMDVESPLDLRIHRIASFLDH

BO01096.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
sug-PA 384 CG3850-PA 1..384 1..384 2105 100 Plus
sug-PB 322 CG3850-PB 1..322 63..384 1751 100 Plus
ci-PB 1279 CG2125-PB 291..483 93..277 465 46.7 Plus
ci-PA 1397 CG2125-PA 409..601 93..277 465 46.7 Plus
lmd-PB 866 CG4677-PB 333..584 53..276 463 39.5 Plus