Clone BO01104 Report

Search the DGRC for BO01104

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:4
Vector:pDNR-Dual
Associated Gene/Transcriptp53-RA
Protein status:BO01104.pep: full length peptide match
Sequenced Size:1189

Clone Sequence Records

BO01104.3prime Sequence

862 bp (772 high quality bases) assembled on 2005-11-30

> BO01104.3prime
ATGGTCTAGAAAGCTTGCTGGCAGCTCGTAGGCACGTTTCTTAAGGCTCA
GCAATTTGTTGGCATGGCGACGTAGATTCTCTTGGTTGGGATTGCGCAGG
ACTTCAGCCGCCGCCTCCTTAATCATGCCCTCGATGCTCTGCAGCAGCCA
TTCCTTATTGGGGCACGTAATAGCCAGACGGTAATCGCCATCCGGTGTCC
GCGACACGTTCCACTCTGCGGCGGAGTCGTCGCAGTCTCGGCTATCATTG
CTCTCCGTGTCCTCCGTCTTTATAGCAATGCACCGACGCACCTTGGACGG
CTCATCTTCTTCGGCGGCTTCCGGCACGGACTTGCGCTTCTTGCTATTGA
GCTGGCGTTCGTCTTGGATGCGATCCCGCTTGGGGCACGTACATATTTTA
ACATGTATAACATGCTGTCCCACGATATCGCCGCATGCTTTCTCCAGGCA
GAAGACTAAGGAAGTTTCTTTTCGCCCGATACACGAGTTTTGGCAGACGA
ACTTGAAGGCCAGGGTCTGGCGCGTGAGCCCACTGCGGGTTACAGACCGG
CTCATGTTCAGGGGGACTACAACGGAAAAACGCTCGGAAATTCCCTTGCC
CTGAGCATTTCCACAATATACACTGTTGGGATTCTCGCTGCGCAGCAAGC
TCTCGCGCATTTTTGCGTTATTGGCCGTCAAAGGCTCAACGCTAAGGTGA
TTTTGACAGCGGACCACGGGAGCACTCACATCATTGGAGAAGCAAAGGAA
CACACGCAAATTAAGTGGTTGGATGGGCATTTTAGACTTGAACTGAACGT
CCACGTTGAAGGCCTTGTTTCATCGGATGTAGAGCTTGTTCAGCGGAATC
GAGTACATCCAA

BO01104.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG33336-PA 1158 p53-RA 355..1155 819..19 4005 100 Minus
CG33336-PB 1488 p53-RB 685..1485 819..19 4005 100 Minus
CG33336-PA 1158 p53-RA 312..350 862..824 195 100 Minus
CG33336-PB 1488 p53-RB 642..680 862..824 195 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
p53-RE 1324 CG33336-RE 170..1013 862..19 4175 99.8 Minus
p53-RC 2095 CG33336-RC 941..1784 862..19 4175 99.8 Minus
p53-RB 1870 CG33336-RB 716..1559 862..19 4175 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23050047..23050442 39..434 1980 100 Plus
3R 32079331 3R 23050504..23050750 434..680 1235 100 Plus
3R 32079331 3R 23050815..23050996 681..862 850 97.8 Plus
Blast to na_te.dros performed on 2015-02-12 00:42:07 has no hits.

BO01104.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:21 Download gff for BO01104.3prime
Subject Subject Range Query Range Percent Splice Strand
p53-PB 644..1488 16..860 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:35 Download gff for BO01104.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33336-PB 644..1488 16..860 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:31:51 Download gff for BO01104.3prime
Subject Subject Range Query Range Percent Splice Strand
p53-RB 718..1565 11..860 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:11:56 Download gff for BO01104.3prime
Subject Subject Range Query Range Percent Splice Strand
p53-RB 718..1565 11..860 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:11:56 Download gff for BO01104.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 23050815..23050994 681..860 98   Plus
3R 23050504..23050750 434..680 100 <- Plus
3R 23050047..23050441 39..433 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:31:51 Download gff for BO01104.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18876537..18876716 681..860 98   Plus
arm_3R 18876226..18876472 434..680 100 <- Plus
arm_3R 18875769..18876163 39..433 100 <- Plus

BO01104.5prime Sequence

847 bp (810 high quality bases) assembled on 2005-11-30

> BO01104.5prime
GAAGTTATCAGTCGACATGTATATATCACAGCCAATGTCGTGGCACAAAG
AAAGCACTGATTCCGAGGATGACTCCACGGAGGTCGATATCAAGGAGGAT
ATTCCGAAAACGGTGGAGGTATCGGGATCGGAATTGACCACGGAACCCAT
GGCCTTCTTGCAGGGATTAAACTCCGGGAATCTGATGCAGTTCAGCCAGC
AATCCGTGCTGCGCGAAATGATGCTGCAGGACATTCAGATCCAGGCGAAC
ACGCTGCCCAAGCTAGAGAATCACAACATCGGTGGTTATTGCTTCAGCAT
GGTTCTGGATGAGCCGCCCAAGTCTCTTTGGATGTACTCGATTCCGCTGA
ACAAGCTCTACATCCGGATGAACAAGGCCTTCAACGTGGACGTTCAGTTC
AAGTCTAAAATGCCCATCCAACCACTTAATTTGCGTGTGTTCCTTTGCTT
CTCCAATGATGTGAGTGCTCCCGTGGTCCGCTGTCAAAATCACCTTAGCG
TTGAGCCTTTGACGGCCAATAACGCAAAAATGCGCGAGAGCTTGCTGCGC
AGCGAGAATCCCAACAGTGTATATTGTGGAAATGCTCAGGGCAAGGGAAT
TTCCGAGCGTTTTTCCGTTGTAGTCCCCCTGAACATGAGCCGGTCTGTAA
CCCGCAGTGGGCTCACGCGCCAGACCCTGGCCTTCAAGTTCGTCTGCCAA
AACTCGTGTATCGGGCGAAAAGAAACTTCCTTAGTCTTCTGCCTGGAGAA
AGCATGCGGCGATATCGTGGGACAGCATGTTATACATGTTAAAATATGTA
CGTGCCCCCAGCGGGGATCGCATCAAGACGAACGCCAGCTCAATAGC

BO01104.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG33336-PA 1158 p53-RA 1..799 17..815 3970 99.8 Plus
CG33336-PB 1488 p53-RB 368..1129 54..815 3785 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
p53-RC 2095 CG33336-RC 630..1460 17..847 4095 99.6 Plus
p53-RA 1577 CG33336-RA 112..942 17..847 4095 99.6 Plus
p53-RB 1870 CG33336-RB 442..1235 54..847 3910 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23050815..23051127 509..197 1565 100 Minus
3R 32079331 3R 23050504..23050750 756..510 1235 100 Minus
3R 32079331 3R 23053118..23053201 136..53 420 100 Minus
3R 32079331 3R 23050351..23050442 847..756 350 96.8 Minus
3R 32079331 3R 23053357..23053394 54..17 190 100 Minus
3R 32079331 3R 23053012..23053048 172..136 185 100 Minus
Blast to na_te.dros performed on 2015-02-11 15:29:16 has no hits.

BO01104.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:22 Download gff for BO01104.5prime
Subject Subject Range Query Range Percent Splice Strand
p53-PA 1..831 17..847 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:36 Download gff for BO01104.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33336-PA 1..831 17..847 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:47:01 Download gff for BO01104.5prime
Subject Subject Range Query Range Percent Splice Strand
p53-RA 112..942 17..847 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:05:18 Download gff for BO01104.5prime
Subject Subject Range Query Range Percent Splice Strand
p53-RA 112..942 17..847 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:05:18 Download gff for BO01104.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 23053357..23053394 17..54 100   Minus
3R 23053119..23053199 55..135 100 <- Minus
3R 23053012..23053048 136..172 100 <- Minus
3R 23052922..23052948 173..199 100 <- Minus
3R 23050815..23051124 200..509 100 <- Minus
3R 23050504..23050750 510..756 100 <- Minus
3R 23050351..23050441 757..847 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:47:01 Download gff for BO01104.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18879079..18879116 17..54 100   Minus
arm_3R 18878841..18878921 55..135 100 <- Minus
arm_3R 18878734..18878770 136..172 100 <- Minus
arm_3R 18878644..18878670 173..199 100 <- Minus
arm_3R 18876537..18876846 200..509 100 <- Minus
arm_3R 18876226..18876472 510..756 100 <- Minus
arm_3R 18876073..18876163 757..847 96 <- Minus

BO01104.complete Sequence

1189 bp (1189 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629422

> BO01104.complete
GAAGTTATCAGTCGACATGTATATATCACAGCCAATGTCGTGGCACAAAG
AAAGCACTGATTCCGAGGATGACTCCACGGAGGTCGATATCAAGGAGGAT
ATTCCGAAAACGGTGGAGGTATCGGGATCGGAATTGACCACGGAACCCAT
GGCCTTCTTGCAGGGATTAAACTCCGGGAATCTGATGCAGTTCAGCCAGC
AATCCGTGCTGCGCGAAATGATGCTGCAGGACATTCAGATCCAGGCGAAC
ACGCTGCCCAAGCTAGAGAATCACAACATCGGTGGTTATTGCTTCAGCAT
GGTTCTGGATGAGCCGCCCAAGTCTCTTTGGATGTACTCGATTCCGCTGA
ACAAGCTCTACATCCGGATGAACAAGGCCTTCAACGTGGACGTTCAGTTC
AAGTCTAAAATGCCCATCCAACCACTTAATTTGCGTGTGTTCCTTTGCTT
CTCCAATGATGTGAGTGCTCCCGTGGTCCGCTGTCAAAATCACCTTAGCG
TTGAGCCTTTGACGGCCAATAACGCAAAAATGCGCGAGAGCTTGCTGCGC
AGCGAGAATCCCAACAGTGTATATTGTGGAAATGCTCAGGGCAAGGGAAT
TTCCGAGCGTTTTTCCGTTGTAGTCCCCCTGAACATGAGCCGGTCTGTAA
CCCGCAGTGGGCTCACGCGCCAGACCCTGGCCTTCAAGTTCGTCTGCCAA
AACTCGTGTATCGGGCGAAAAGAAACTTCCTTAGTCTTCTGCCTGGAGAA
AGCATGCGGCGATATCGTGGGACAGCATGTTATACATGTTAAAATATGTA
CGTGCCCCAAGCGGGATCGCATCCAAGACGAACGCCAGCTCAATAGCAAG
AAGCGCAAGTCCGTGCCGGAAGCCGCCGAAGAAGATGAGCCGTCCAAGGT
GCGTCGGTGCATTGCTATAAAGACGGAGGACACGGAGAGCAATGATAGCC
GAGACTGCGACGACTCCGCCGCAGAGTGGAACGTGTCGCGGACACCGGAT
GGCGATTACCGTCTGGCTATTACGTGCCCCAATAAGGAATGGCTGCTGCA
GAGCATCGAGGGCATGATTAAGGAGGCGGCGGCTGAAGTCCTGCGCAATC
CCAACCAAGAGAATCTACGTCGCCATGCCAACAAATTGCTGAGCCTTAAG
AAACGTGCCTACGAGCTGCCAGCAAGCTTTCTAGACCAT

BO01104.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
p53-RC 1158 CG33336-PC 1..1155 17..1171 5775 100 Plus
p53-RA 1158 CG33336-PA 1..1155 17..1171 5775 100 Plus
p53-RB 1488 CG33336-PB 368..1485 54..1171 5590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
p53-RC 2095 CG33336-RC 630..1784 17..1171 5775 100 Plus
p53-RA 1577 CG33336-RA 112..1266 17..1171 5775 100 Plus
p53-RB 1870 CG33336-RB 442..1559 54..1171 5590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23050047..23050442 1151..756 1980 100 Minus
3R 32079331 3R 23050815..23051127 509..197 1565 100 Minus
3R 32079331 3R 23050504..23050750 756..510 1235 100 Minus
3R 32079331 3R 23053118..23053201 136..53 420 100 Minus
3R 32079331 3R 23053357..23053394 54..17 190 100 Minus
3R 32079331 3R 23053012..23053048 172..136 185 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:38:09 has no hits.

BO01104.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:09 Download gff for BO01104.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 1..1158 17..1174 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:03 Download gff for BO01104.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 96..1256 17..1179 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:43:23 Download gff for BO01104.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 112..1266 17..1173 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:09 Download gff for BO01104.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 96..1256 17..1179 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:49:33 Download gff for BO01104.complete
Subject Subject Range Query Range Percent Splice Strand
p53-RA 112..1266 17..1173 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:49:33 Download gff for BO01104.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23053357..23053394 17..54 100   Minus
3R 23053119..23053199 55..135 100 <- Minus
3R 23053012..23053048 136..172 100 <- Minus
3R 23052922..23052948 173..199 100 <- Minus
3R 23050815..23051124 200..509 100 <- Minus
3R 23050504..23050750 510..756 100 <- Minus
3R 23050047..23050441 757..1151 100 <- Minus
3R 23049964..23049987 1152..1173 91 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:43:23 Download gff for BO01104.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18879079..18879116 17..54 100   Minus
arm_3R 18878841..18878921 55..135 100 <- Minus
arm_3R 18878734..18878770 136..172 100 <- Minus
arm_3R 18878644..18878670 173..199 100 <- Minus
arm_3R 18876537..18876846 200..509 100 <- Minus
arm_3R 18876226..18876472 510..756 100 <- Minus
arm_3R 18875769..18876163 757..1151 100 <- Minus
arm_3R 18875686..18875709 1152..1173 91 <- Minus

BO01104.pep Sequence

Translation from 16 to 1189

> BO01104.pep
MYISQPMSWHKESTDSEDDSTEVDIKEDIPKTVEVSGSELTTEPMAFLQG
LNSGNLMQFSQQSVLREMMLQDIQIQANTLPKLENHNIGGYCFSMVLDEP
PKSLWMYSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVFLCFSNDVS
APVVRCQNHLSVEPLTANNAKMRESLLRSENPNSVYCGNAQGKGISERFS
VVVPLNMSRSVTRSGLTRQTLAFKFVCQNSCIGRKETSLVFCLEKACGDI
VGQHVIHVKICTCPKRDRIQDERQLNSKKRKSVPEAAEEDEPSKVRRCIA
IKTEDTESNDSRDCDDSAAEWNVSRTPDGDYRLAITCPNKEWLLQSIEGM
IKEAAAEVLRNPNQENLRRHANKLLSLKKRAYELPASFLDH

BO01104.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
p53-PC 385 CG33336-PC 1..385 1..385 2008 100 Plus
p53-PA 385 CG33336-PA 1..385 1..385 2008 100 Plus
p53-PB 495 CG33336-PB 122..495 12..385 1935 99.5 Plus
p53-PE 334 CG33336-PE 10..334 61..385 1695 99.7 Plus