Clone BO01108 Report

Search the DGRC for BO01108

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG10267-RA
Protein status:BO01108.pep: full length peptide match
Sequenced Size:1198

Clone Sequence Records

BO01108.3prime Sequence

866 bp (729 high quality bases) assembled on 2005-11-30

> BO01108.3prime
ATGGTCTAGAAAGCTTGCGTGAGCTTGAATTCGGATCTCGTTCCCGCCCC
CCTGCTCGGCCACCATTTCCACCTTCATGCTCTCGGCCAGCATTACGGCG
TTCTGGTGCAGTTTGGTCTCCTCGTGCTGGCGCATGTGATGCAGCAGACG
GAAGTCCTTGTTGCAATAATCGCAGCGGTACAGTTTGATGTCCGAGTGGA
TGAGCTCGTGCTTGGTCAGGGAGTGAGCGTAGGCAAACGCTTTGTCGCAC
ACCTTGCACACGTAGGGCTTGATGCCACGGTGAACATTTTCATGAGACTT
GAGAACACTTTCGTAGAAGAATTGACGACTGCAGAAGCTGCACTTATAGG
GTTTGCTGCCCGTGTGGGAGTACATGTGCTTCCTCAGTTGCTCGCGCACC
TGGAACTTGGCATCGCATAGTTCGCATGCATATTGGCAGATGCCGTCATG
GCGTCTGCGATGCTCCATCATCCGGCCGCGCTTTTCGTAAAAGTTTCCGC
AGACGTCGCAGATATAGCCACCCTTCTCAGTGCCGTCCGATGTTGTTAGG
GAGTTTAATCCGCGACGAACCCGGCCGCGCCGCGCCTTCAGGCTTGCCTT
GGCCGCCTCCTGCAGCGCCAACTGCTGCGATGGTGTCTCTTCGTACTGCT
TCTCAGACTCCAGGACGATCTCGGTCTGATCGGAGTTCATCTCGATGGTG
TAGTTGTCCTCCAAGTACTCGATGGTGTCGCCAATGCACTCCTGCTGATC
GCTGGTGTCCACTTCCAAGTACTCCTCGTGCCCCTTTTCTTCCTGGTGCT
CCTCTTCCCCGGTGGGTGGTCTCCTCCAGGATGTACATCTCCTCGTCGCA
TTGCTGCTGCGAAGCG

BO01108.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG10267-PA 1167 CG10267-RA 368..1164 815..19 3985 100 Minus
CG10267-PA 1167 CG10267-RA 322..369 862..815 240 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
Zif-RC 1455 CG10267-RC 461..1303 862..19 4195 99.9 Minus
Zif-RB 1394 CG10267-RB 400..1242 862..19 4195 99.9 Minus
Zif-RA 1463 CG10267-RA 469..1311 862..19 4195 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6457670..6458109 862..422 2155 99.8 Minus
3R 32079331 3R 6458403..6458670 286..19 1340 100 Minus
3R 32079331 3R 6458167..6458301 421..287 675 100 Minus
Blast to na_te.dros performed on 2015-02-13 01:01:13 has no hits.

BO01108.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:25 Download gff for BO01108.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10267-PA 318..1167 16..866 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:40 Download gff for BO01108.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10267-PA 318..1167 16..866 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:28:30 Download gff for BO01108.3prime
Subject Subject Range Query Range Percent Splice Strand
Zif-RA 465..1317 13..866 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:06:31 Download gff for BO01108.3prime
Subject Subject Range Query Range Percent Splice Strand
Zif-RA 465..1317 13..866 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:06:31 Download gff for BO01108.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 6458403..6458676 13..286 98   Minus
3R 6458167..6458301 287..421 100 -> Minus
3R 6457666..6458109 422..866 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:28:30 Download gff for BO01108.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2284125..2284398 13..286 98   Minus
arm_3R 2283889..2284023 287..421 100 -> Minus
arm_3R 2283388..2283831 422..866 99 -> Minus

BO01108.5prime Sequence

806 bp (773 high quality bases) assembled on 2005-11-30

> BO01108.5prime
GAAGTTATCAGTCGACATGCGCGTCGAGCTTACCCCACAGACGTGCCGGG
TCTGCCTGGCGCAGAGTGAGCGACTGCAGCGCCTAGACGAGATCCGCGAG
GAAGGCGAGGAATCGCCGAACGAGATGTTGATTCAACTTTTGGGAGTCTC
ATACAGCAATCTGAACGACAGAGAACACATACCCGATGGCATCTGCAAGT
CCTGCAAGGTCGAACTCAACATGGCCTACCAGTTTCGCGAGAAGGCGCTG
CGCAAGCAGATGGAGATTGAGGAGTACTGCCGGGAACTGGGCTTGCTGGA
CGAATCAGATGTGATGATGATCAAGGAGGAGGACGGCTCGCAGCAGCAAT
GCGACGAGGAGATGTACATCCTGGAGGAGACCACCACCGGGGAAGAGGAG
CACCAGGAAGAAAAGGGGCACGAGGAGTACTTGGAAGTGGACACCAGCGA
TCAGCAGGAGTGCATTGGCGACACCATCGAGTACTTGGAGGACAACTACA
CCATCGAGATGAACTCCGATCAGACCGAGATCGTCCTGGAGTCTGAGAAG
CAGTACGAAGAGACACCATCGCAGCAGTTGGCGCTGCAGGAGGCGGCCAA
GGCAAGCCTGAAGGCGCGGCGCGGCCGGGTTCGTCGCGGATTAAACTCCC
TAACAACATCGGACGGCACTGAGAAGGGTGGCTATATCTGCGACGTCTGC
GGAAACTTTTACGAAAAGCGCGGCCGGATGATGGAGCATCGCAGACGCCA
TGACGGCATCTGCCAATATGCATGCGAACTATGCGATGCCAAGTTCCAGG
TGCGCG

BO01108.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG10267-PA 1167 CG10267-RA 1..790 17..806 3950 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 05:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Zif-RC 1455 CG10267-RC 140..929 17..806 3950 100 Plus
Zif-RB 1394 CG10267-RB 79..868 17..806 3950 100 Plus
Zif-RA 1463 CG10267-RA 148..937 17..806 3950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 05:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6457493..6458109 161..777 3085 100 Plus
3R 32079331 3R 6457287..6457430 17..160 720 100 Plus
Blast to na_te.dros performed on 2015-02-13 05:55:14 has no hits.

BO01108.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:26 Download gff for BO01108.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10267-PA 1..790 17..806 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:42 Download gff for BO01108.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10267-PA 1..790 17..806 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 17:49:16 Download gff for BO01108.5prime
Subject Subject Range Query Range Percent Splice Strand
Zif-RA 144..937 9..806 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 07:57:50 Download gff for BO01108.5prime
Subject Subject Range Query Range Percent Splice Strand
Zif-RA 144..937 9..806 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 07:57:50 Download gff for BO01108.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 6458167..6458195 778..806 100   Plus
3R 6457493..6458109 161..777 100 -> Plus
3R 6457283..6457430 9..160 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 17:49:16 Download gff for BO01108.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2283889..2283917 778..806 100   Plus
arm_3R 2283215..2283831 161..777 100 -> Plus
arm_3R 2283005..2283152 9..160 97 -> Plus

BO01108.complete Sequence

1198 bp (1198 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629423

> BO01108.complete
GAAGTTATCAGTCGACATGCGCGTCGAGCTTACCCCACAGACGTGCCGGG
TCTGCCTGGCGCAGAGTGAGCGACTGCAGCGCCTAGACGAGATCCGCGAG
GAAGGCGAGGAATCGCCGAACGAGATGTTGATTCAACTTTTGGGAGTCTC
ATACAGCAATCTGAACGACAGAGAACACATACCCGATGGCATCTGCAAGT
CCTGCAAGGTCGAACTCAACATGGCCTACCAGTTTCGCGAGAAGGCGCTG
CGCAAGCAGATGGAGATTGAGGAGTACTGCCGGGAACTGGGCTTGCTGGA
CGAATCAGATGTGATGATGATCAAGGAGGAGGACGGCTCGCAGCAGCAAT
GCGACGAGGAGATGTACATCCTGGAGGAGACCACCACCGGGGAAGAGGAG
CACCAGGAAGAAAAGGGGCACGAGGAGTACTTGGAAGTGGACACCAGCGA
TCAGCAGGAGTGCATTGGCGACACCATCGAGTACTTGGAGGACAACTACA
CCATCGAGATGAACTCCGATCAGACCGAGATCGTCCTGGAGTCTGAGAAG
CAGTACGAAGAGACACCATCGCAGCAGTTGGCGCTGCAGGAGGCGGCCAA
GGCAAGCCTGAAGGCGCGGCGCGGCCGGGTTCGTCGCGGATTAAACTCCC
TAACAACATCGGACGGCACTGAGAAGGGTGGCTATATCTGCGACGTCTGC
GGAAACTTTTACGAAAAGCGCGGCCGGATGATGGAGCATCGCAGACGCCA
TGACGGCATCTGCCAATATGCATGCGAACTATGCGATGCCAAGTTCCAGG
TGCGCGAGCAACTGAGGAAGCACATGTACTCCCACACGGGCAGCAAACCC
TATAAGTGCAGCTTCTGCAGTCGTCAATTCTTCTACGAAAGTGTTCTCAA
GTCTCATGAAAATGTTCACCGTGGCATCAAGCCCTACGTGTGCAAGGTGT
GCGACAAAGCGTTTGCCTACGCTCACTCCCTGACCAAGCACGAGCTCATC
CACTCGGACATCAAACTGTACCGCTGCGATTATTGCAACAAGGACTTCCG
TCTGCTGCATCACATGCGCCAGCACGAGGAGACCAAACTGCACCAGAACG
CCGTAATGCTGGCCGAGAGCATGAAGGTGGAAATGGTGGCCGAGCAGGGG
GGCGGGAACGAGATCCGAATTCAAGCTCACGCAAGCTTTCTAGACCAT

BO01108.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Zif-RC 1167 CG10267-PC 1..1164 17..1180 5820 100 Plus
Zif-RB 1167 CG10267-PB 1..1164 17..1180 5820 100 Plus
Zif-RA 1167 CG10267-PA 1..1164 17..1180 5820 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Zif-RC 1455 CG10267-RC 140..1303 17..1180 5820 100 Plus
Zif-RB 1394 CG10267-RB 79..1242 17..1180 5820 100 Plus
Zif-RA 1463 CG10267-RA 148..1311 17..1180 5820 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6457493..6458109 161..777 3085 100 Plus
3R 32079331 3R 6458403..6458670 913..1180 1340 100 Plus
3R 32079331 3R 6457287..6457430 17..160 720 100 Plus
3R 32079331 3R 6458167..6458301 778..912 675 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:41:48 has no hits.

BO01108.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:10 Download gff for BO01108.complete
Subject Subject Range Query Range Percent Splice Strand
CG10267-RA 1..1167 17..1183 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:05 Download gff for BO01108.complete
Subject Subject Range Query Range Percent Splice Strand
CG10267-RA 130..1303 9..1186 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:29:45 Download gff for BO01108.complete
Subject Subject Range Query Range Percent Splice Strand
Zif-RA 148..1311 17..1182 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:11 Download gff for BO01108.complete
Subject Subject Range Query Range Percent Splice Strand
CG10267-RA 130..1303 9..1186 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:36:25 Download gff for BO01108.complete
Subject Subject Range Query Range Percent Splice Strand
Zif-RA 148..1311 17..1182 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:36:25 Download gff for BO01108.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6458403..6458670 913..1182 99   Plus
3R 6458167..6458301 778..912 100 -> Plus
3R 6457493..6458109 161..777 100 -> Plus
3R 6457287..6457430 17..160 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:29:45 Download gff for BO01108.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2284125..2284392 913..1182 99   Plus
arm_3R 2283889..2284023 778..912 100 -> Plus
arm_3R 2283215..2283831 161..777 100 -> Plus
arm_3R 2283009..2283152 17..160 100 -> Plus

BO01108.pep Sequence

Translation from 16 to 1198

> BO01108.pep
MRVELTPQTCRVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLN
DREHIPDGICKSCKVELNMAYQFREKALRKQMEIEEYCRELGLLDESDVM
MIKEEDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEYLEVDTSDQQECI
GDTIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKASLKA
RRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQ
YACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENV
HRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLLHHM
RQHEETKLHQNAVMLAESMKVEMVAEQGGGNEIRIQAHASFLDH

BO01108.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Zif-PC 388 CG10267-PC 1..388 1..388 2065 100 Plus
Zif-PB 388 CG10267-PB 1..388 1..388 2065 100 Plus
Zif-PA 388 CG10267-PA 1..388 1..388 2065 100 Plus
M1BP-PA 418 CG9797-PA 12..409 9..384 399 27.6 Plus
CG14710-PB 415 CG14710-PB 10..400 10..361 384 27.7 Plus