Clone BO01110 Report

Search the DGRC for BO01110

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG5641-RA
Protein status:BO01110.pep: full length peptide match
Sequenced Size:1222

Clone Sequence Records

BO01110.3prime Sequence

812 bp (739 high quality bases) assembled on 2005-11-30

> BO01110.3prime
ATGGTCTAGAAAGCTTGCCTCGGCGCCATCGTCGCTGCCCTCTTCTTCGT
TCTCATTCTCGATCATGTCGATGTCCTCCTCGAGGTCGCCCTCCTTCTTG
TCCGTTGGCTTCTCGTAGACAGCGGTCAGCGGGGAAATGCACACGCCGTT
CCAGACGGACATTTCGCGCACAACGCTGGTGTTGCCCTCCAGTCCCAAAA
TGTGTTTGTATCCGCCGTGGGCCAGCACGCGCAGTAGTGTCTGCGATGTG
TAGCAGCACACATCCTGCTGCTCCAATGTCATGGCAGTGTGCACACGGAT
GTGTCCCGGCTCGGTGGGATCCGTGATGCCGGCCGAGCCCGGCAGGAAGA
GCCCGGCGGAGAGTAGCTGAAAGACGCGACGGAAGGCCAGGTTGATGGGC
AGTGCCTGTCGCGACGGGTTGTTCATGATGGCCAAATGGGCGATCAGGTC
CAGCATCCAGGCCGACAGCGGCGAAAAAGCGTCGAAACGCCTAGTGAGAT
CCTTGAGAATGCGAATGAGCACCTTTATCGAGGAGTGGTGGGCATTTTCC
TCAAACCAGCGCGTGTGCCGAATGGCAGCCAGATGGCTCTGCATCAGTTT
GTGATCCAAATGGATCTCAGGCTCCAGCTTGCGAAGATTCTGCGGCAAGG
TGGCGATCAGAATGCGCACCTTGGCATGCACGTTGGCGATGTCGAAGCCC
CGCTCATGGATCTGTACGGTGTGCTGATCGCCCTTGGTCAGAACTTCAGT
CTTCATGCTGGCCTTCAGGTCGGCCTCCACTTTTTTGGCCAGCGCATCGA
CGGCCTCCTTGG

BO01110.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-PA 1191 CG5641-RA 395..1188 812..19 3970 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-RA 1365 CG5641-RA 476..1269 812..19 3970 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12427891..12428684 19..812 3970 100 Plus
Blast to na_te.dros performed on 2015-02-12 10:10:04 has no hits.

BO01110.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:29 Download gff for BO01110.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5641-PA 395..1191 15..812 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:45 Download gff for BO01110.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5641-PA 395..1191 15..812 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:47:25 Download gff for BO01110.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 476..1272 15..812 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:10:33 Download gff for BO01110.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 476..1272 15..812 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:10:33 Download gff for BO01110.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 12427888..12428684 15..812 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:47:25 Download gff for BO01110.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8253610..8254406 15..812 99   Plus

BO01110.5prime Sequence

864 bp (761 high quality bases) assembled on 2005-11-30

> BO01110.5prime
GAAGTTATCAGTCGACATGGTTCGCGGAGCTCTCCGAGGTGGCCGCCCCA
TGCGCGGCGGCATACGTCCGCCGTTCAAAAAGACATTCGTGCCGCGCCAC
CCCTTCGATCTGACCCTCGCGGAGGTCTTCTTTCCCAAAGTTCCATCCGC
CGGCGCCGTTGACGATTCTGCTTTGACTGCGGCGCTGCTGAAGCGTAACC
AGGACCTGAGTCCCACTCCCAGCGAGCAGACGGCTATTGGCAATCTAGTG
ACCAAGGTGCAGGCTGTTCTCGACAATCTGGTGGTTGCACCCGGGGATCT
GACAACTTGTCAACTGGAGGAAGTGCGTCAGGTTGGCTCCTTCAAGAAGG
GCACCATACTGACGGGCAACAATGTAGCCGATGTGGTGGTTATCCTCAAA
ACCCTGCCCACCAAGGAGGCCGTCGATGCGCTGGCCAAAAAAGTGGAGGC
CGACCTGAAGGCCAGCATGAAGACTGAAGTTCTGACCAAGGGCGATCAGC
ACACCGTACAGATCCATGAGCGGGGCTTCGACATCGCCAACGTGCATGCC
AAGGTGCGCATTCTGATCGCCACCTTGCCGCAGAATCTTCGCAAGCTGGA
GCCTGAGATCCATTTGGATCACAAACTGATGCAGAGCCATCTGGCTGCCA
TTCGGCACACGCGCTGGTTTGAGGAAAATGCCCACCACTCCTCGATAAAG
GTGCTCATTCGCATTCTCAAGGATCTCACTAGGCGTTTCGACGCTTTTTC
GCCGCTGTCGGCCTGGATGCTGGACCTGATCGCCCATTTGGCCATCATGA
AACACCCGTCGCGACAGGCACTGCCCATCAACCTGGCCTTCCGTCGCGTC
TTTCAGCTACTCTC

BO01110.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-PA 1191 CG5641-RA 1..848 17..864 4190 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-RA 1365 CG5641-RA 82..929 17..864 4210 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12428231..12428784 864..311 2740 99.6 Minus
3R 32079331 3R 12429036..12429201 182..17 830 100 Minus
3R 32079331 3R 12428846..12428975 310..181 650 100 Minus
Blast to na_te.dros performed on 2015-02-04 18:44:24 has no hits.

BO01110.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:30 Download gff for BO01110.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5641-PA 1..848 17..864 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:47 Download gff for BO01110.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5641-PA 1..848 17..864 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:11:09 Download gff for BO01110.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 75..929 9..864 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:26:11 Download gff for BO01110.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 75..929 9..864 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:26:11 Download gff for BO01110.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 12429037..12429208 9..181 97   Minus
3R 12428846..12428974 182..310 100 <- Minus
3R 12428231..12428784 311..864 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:11:09 Download gff for BO01110.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8254759..8254930 9..181 97   Minus
arm_3R 8254568..8254696 182..310 100 <- Minus
arm_3R 8253953..8254506 311..864 99 <- Minus

BO01110.complete Sequence

1222 bp (1222 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629424

> BO01110.complete
GAAGTTATCAGTCGACATGGTTCGCGGAGCTCTCCGAGGTGGCCGCCCCA
TGCGCGGCGGCATACGTCCGCCGTTCAAAAAGACATTCGTGCCGCGCCAC
CCCTTCGATCTGACCCTCGCGGAGGTCTTCTTTCCCAAAGTTCCATCCGC
CGGCGCCGTTGACGATTCTGCTTTGACTGCGGCGCTGCTGAAGCGTAACC
AGGACCTGAGTCCCACTCCCAGCGAGCAGACGGCTATTGGCAATCTAGTG
ACCAAGGTGCAGGCTGTTCTCGACAATCTGGTGGTTGCACCCGGGGATCT
GACAACTTGTCAACTGGAGGAAGTGCGTCAGGTTGGCTCCTTCAAGAAGG
GCACCATACTGACGGGCAACAATGTAGCCGATGTGGTGGTTATCCTCAAA
ACCCTGCCCACCAAGGAGGCCGTCGATGCGCTGGCCAAAAAAGTGGAGGC
CGACCTGAAGGCCAGCATGAAGACTGAAGTTCTGACCAAGGGCGATCAGC
ACACCGTACAGATCCATGAGCGGGGCTTCGACATCGCCAACGTGCATGCC
AAGGTGCGCATTCTGATCGCCACCTTGCCGCAGAATCTTCGCAAGCTGGA
GCCTGAGATCCATTTGGATCACAAACTGATGCAGAGCCATCTGGCTGCCA
TTCGGCACACGCGCTGGTTTGAGGAAAATGCCCACCACTCCTCGATAAAG
GTGCTCATTCGCATTCTCAAGGATCTCACTAGGCGTTTCGACGCTTTTTC
GCCGCTGTCGGCCTGGATGCTGGACCTGATCGCCCATTTGGCCATCATGA
ACAACCCGTCGCGACAGGCACTGCCCATCAACCTGGCCTTCCGTCGCGTC
TTTCAGCTACTCTCCGCCGGGCTCTTCCTGCCGGGCTCGGCCGGCATCAC
GGATCCCACCGAGCCGGGACACATCCGTGTGCACACTGCCATGACATTGG
AGCAGCAGGATGTGTGCTGCTACACATCGCAGACACTACTGCGCGTGCTG
GCCCACGGCGGATACAAACACATTTTGGGACTGGAGGGCAACACCAGCGT
TGTGCGCGAAATGTCCGTCTGGAACGGCGTGTGCATTTCCCCGCTGACCG
CTGTCTACGAGAAGCCAACGGACAAGAAGGAGGGCGACCTCGAGGAGGAC
ATCGACATGATCGAGAATGAGAACGAAGAAGAGGGCAGCGACGATGGCGC
CGAGGCAAGCTTTCTAGACCAT

BO01110.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-RA 1191 CG5641-PA 1..1188 17..1204 5940 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-RA 1365 CG5641-RA 82..1269 17..1204 5940 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12427891..12428784 1204..311 4470 100 Minus
3R 32079331 3R 12429036..12429201 182..17 830 100 Minus
3R 32079331 3R 12428846..12428975 310..181 650 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:45:28 has no hits.

BO01110.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:12 Download gff for BO01110.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 1..1191 17..1208 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:07 Download gff for BO01110.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 73..1270 9..1208 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:41:56 Download gff for BO01110.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 82..1269 17..1206 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:12 Download gff for BO01110.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 73..1270 9..1208 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:59:39 Download gff for BO01110.complete
Subject Subject Range Query Range Percent Splice Strand
CG5641-RA 82..1269 17..1206 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:39 Download gff for BO01110.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12429037..12429201 17..181 100   Minus
3R 12428846..12428974 182..310 100 <- Minus
3R 12427889..12428784 311..1206 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:41:56 Download gff for BO01110.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8254759..8254923 17..181 100   Minus
arm_3R 8254568..8254696 182..310 100 <- Minus
arm_3R 8253611..8254506 311..1206 99 <- Minus

BO01110.pep Sequence

Translation from 16 to 1222

> BO01110.pep
MVRGALRGGRPMRGGIRPPFKKTFVPRHPFDLTLAEVFFPKVPSAGAVDD
SALTAALLKRNQDLSPTPSEQTAIGNLVTKVQAVLDNLVVAPGDLTTCQL
EEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVDALAKKVEADLKAS
MKTEVLTKGDQHTVQIHERGFDIANVHAKVRILIATLPQNLRKLEPEIHL
DHKLMQSHLAAIRHTRWFEENAHHSSIKVLIRILKDLTRRFDAFSPLSAW
MLDLIAHLAIMNNPSRQALPINLAFRRVFQLLSAGLFLPGSAGITDPTEP
GHIRVHTAMTLEQQDVCCYTSQTLLRVLAHGGYKHILGLEGNTSVVREMS
VWNGVCISPLTAVYEKPTDKKEGDLEEDIDMIENENEEEGSDDGAEASFL
DH

BO01110.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG5641-PA 396 CG5641-PA 1..396 1..396 2030 100 Plus
Zn72D-PD 884 CG5215-PD 545..836 62..352 194 25.7 Plus
Zn72D-PC 884 CG5215-PC 545..836 62..352 194 25.7 Plus
Zn72D-PF 884 CG5215-PF 545..836 62..352 194 25.7 Plus
Zn72D-PB 884 CG5215-PB 545..836 62..352 194 25.7 Plus