Clone BO01113 Report

Search the DGRC for BO01113

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG9609-RA
Protein status:BO01113.pep:
Sequenced Size:1243

Clone Sequence Records

BO01113.3prime Sequence

860 bp (783 high quality bases) assembled on 2005-11-30

> BO01113.3prime
ATGGTCTAGAAAGCTTGCCTCCTGCTCCTTTTCCTCTTCATCCTGCAGGG
TCTGTGCCAGCAGCTCCTCGACGGGGTCATCCTTCAGCGACTGGGTGATC
TTTTCGAGGACCAAAGGCTGTCGCTCGCGCACCGCCTCATCATCTTCCTT
GTCCAATTGCAGGCAGGCCAGTTTGGATAGCCTCGAATGTTTGCTGCGTC
CAGCATCGCGTCGTCGCTTGCGGGATGTGGACTTAGTTTTGCCCCCTTCT
CCAGTCTTACTCTTGTCCTTCTTCTTGGCTTTCAATTCCTTTTTCGTCGC
ACCATCTTTGTGATCCCTGAGCAGATGTCTCGCCAGATTCTGCGCACTGC
TGAAACAGCGGCCGCAGTCCAAGGCCTGGCACTCGAAACGCCTGCCCGAG
TGGGCGGTGAGCATGTGCTGGCGTAGATTCCTGAGGTACGAGTAACTCTT
GCCGCATCCCTCCTCGTTGCAGGTGAAGGAGGTGGCGCACTCATCCGTCT
GCGCCGCCTCCTTGTGCTTCACCTCGAGGTGACGCTTCAGTTCGCTCGGC
TTGTCGAAGGCACTATCGCAGCGGTCGCACTTATGGCGATTCTTGCCGTG
CAACGAGTCGCGACAATGCTTCGTATACAACGTCCATTTGTCGAACTGCA
GCGGGCAGCCGGGACACTCGTACAGCTTGCAGCTGGGCTCGTGACTCTGG
CACTGCCACTGCTGGTAGAAGCCGCGCGAGCACTTCGAGCAGCTGTACGG
ATACTCCAGCGTGTGCTCCCTGATCTCGTGGCGCTTCAGCTTGAGCTTTT
GCGAGATTTTGGCACTGCACTGGCTGCACGGATAGACCTTTGGGCTCTCG
TGGGTTTCGC

BO01113.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-PA 1212 CG9609-RA 368..1209 860..19 4185 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-RA 1834 CG9609-RA 626..1467 860..19 4195 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16785482..16786323 19..860 4195 99.9 Plus
Blast to na_te.dros performed on 2015-02-11 23:55:50 has no hits.

BO01113.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:32 Download gff for BO01113.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9609-PA 368..1212 18..860 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:51 Download gff for BO01113.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9609-PA 368..1212 18..860 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:31:04 Download gff for BO01113.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 626..1473 13..860 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:55:22 Download gff for BO01113.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 626..1473 13..860 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:55:22 Download gff for BO01113.3prime
Subject Subject Range Query Range Percent Splice Strand
X 16785476..16786323 13..860 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:31:04 Download gff for BO01113.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 16679509..16680356 13..860 99   Plus

BO01113.5prime Sequence

869 bp (742 high quality bases) assembled on 2005-11-30

> BO01113.5prime
GAAGTTATCAGTCGACATGCCGCCTGGAACGCAAATTGCCAGCGACAGCG
ATATGGAGACCGCTCTGGAGGAGTTCAAGCAGCGCCAGGGACGCCGCAAC
AGCATCGGCTCGGCCAAGTACGCGTGCAGCATGCCCAAATGCGAGGCCAC
ATTCAAGCGGCTGGACCAATTGGATCGCCATGAGTATCATCACACAGGGA
TTAAGAAGCACGCCTGCTCGTACGAGGGTTGCGACAAGACGTACTCGATT
GTGACGCACTTAAAGAGGCATCTGCGCAGCACCCACGAGCGTCCGGAGTC
GGCGGCCAAGAAGACGGTGAAGTGCGCGCTGGAGGAGTGCAGCAAGATGT
TCATCTCGGTTAGCAACATGACCCGCCACATGCGCGAAACCCACGAGAGC
CCAAAGGTCTATCCGTGCAGCCAGTGCAGTGCCAAATTCTCGCAAAAGCT
CAAGCTGAAGCGCCACGAGATCAGGGAGCACACGCTGGAGTATCCGTACA
GCTGCTCGAAGTGCTCGCGCGGCTTCTACCAGCAGTGGCAGTGCCAGAGT
CACGAGCCCAGCTGCAAGCTGTACGAGTGTCCCGGCTGCCCGCTGCAGTT
CGACAAATGGACGTTGTATACGAAGCATTGTCGCGACTCGTTGCACGGCA
AGAATCGCCATAAGTGCGACCGCTGCGATAGTGCCTTCGACAAGCCGAGC
GAACTGAAGCGTCACCTCGAGGTGAAGCACAAGGAGGCGGCGCAGACGGA
TGAGTGCGCCACCTCCTTCACCTGCAACGAGGAGGGATGCGGCAAGAGTT
ACTCGTACCTCAGGAATCTACGCCAGCACATGCTCACCGCCCACTCGGGC
AGGCGTTTCGAGTGCCAGG

BO01113.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-PA 1212 CG9609-RA 1..853 17..869 4265 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-RA 1834 CG9609-RA 259..1111 17..869 4265 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16785838..16786504 869..203 3335 100 Minus
X 23542271 X 16786565..16786750 202..17 930 100 Minus
Blast to na_te.dros performed on 2015-02-11 15:30:21 has no hits.

BO01113.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:33 Download gff for BO01113.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9609-PA 1..853 17..869 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:52 Download gff for BO01113.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9609-PA 1..853 17..869 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:47:06 Download gff for BO01113.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 259..1111 17..869 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:07:38 Download gff for BO01113.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 259..1111 17..869 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:07:38 Download gff for BO01113.5prime
Subject Subject Range Query Range Percent Splice Strand
X 16786565..16786750 17..202 100   Minus
X 16785838..16786504 203..869 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:47:06 Download gff for BO01113.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 16680598..16680783 17..202 100   Minus
arm_X 16679871..16680537 203..869 100 <- Minus

BO01113.complete Sequence

1243 bp (1243 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629426

> BO01113.complete
GAAGTTATCAGTCGACATGCCGCCTGGAACGCAAATTGCCAGCGACAGCG
ATATGGAGACCGCTCTGGAGGAGTTCAAGCAGCGCCAGGGACGCCGCAAC
AGCATCGGCTCGGCCAAGTACGCGTGCAGCATGCCCAAATGCGAGGCCAC
ATTCAAGCGGCTGGACCAATTGGATCGCCATGAGTATCATCACACAGGGA
TTAAGAAGCACGCCTGCTCGTACGAGGGTTGCGACAAGACGTACTCGATT
GTGACGCACTTAAAGAGGCATCTGCGCAGCACCCACGAGCGTCCGGAGTC
GGCGGCCAAGAAGACGGTGAAGTGCGCGCTGGAGGAGTGCAGCAAGATGT
TCATCTCGGTTAGCAACATGACCCGCCACATGCGCGAAACCCACGAGAGC
CCAAAGGTCTATCCGTGCAGCCAGTGCAGTGCCAAATTCTCGCAAAAGCT
CAAGCTGAAGCGCCACGAGATCAGGGAGCACACGCTGGAGTATCCGTACA
GCTGCTCGAAGTGCTCGCGCGGCTTCTACCAGCAGTGGCAGTGCCAGAGT
CACGAGCCCAGCTGCAAGCTGTACGAGTGTCCCGGCTGCCCGCTGCAGTT
CGACAAATGGACGTTGTATACGAAGCATTGTCGCGACTCGTTGCACGGCA
AGAATCGCCATAAGTGCGACCGCTGCGATAGTGCCTTCGACAAGCCGAGC
GAACTGAAGCGTCACCTCGAGGTGAAGCACAAGGAGGCGGCGCAGACGGA
TGAGTGCGCCACCTCCTTCACCTGCAACGAGGAGGGATGCGGCAAGAGTT
ACTCGTACCTCAGGAATCTACGCCAGCACATGCTCACCGCCCACTCGGGC
AGGCGTTTCGAGTGCCAGGCCTTGGACTGCGGCCGCTGTTTCAGCAGTGC
GCAGAATCTGGCGAGACATCTGCTCAGGGATCACAAAGATGGTGCGACGA
AAAAGGAATTGAAAGCCAAGAAGAAGGACAAGAGTAAGACTGGAGAAGGG
GGCAAAACTAAGTCCACATCCCGCAAGCGACGACGCGATGCTGGACGCAG
CAAACATTCGAGGCTATCCAAACTGGCCTGCCTGCAATTGGACAAGGAAG
ATGATGAGGCGGTGCGCGAGCGACAGCCTTTGGTCCTCGAAAAGATCACC
CAGTCGCTGAAGGATGACCCCGTCGAGGAGCTGCTGGCACAGACCCTGCA
GGATGAAGAGGAAAAGGAGCAGGAGGCAAGCTTTCTAGACCAT

BO01113.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-RA 1212 CG9609-PA 1..1209 17..1225 6045 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-RA 1834 CG9609-RA 259..1467 17..1225 6045 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16785482..16786504 1225..203 5115 100 Minus
X 23542271 X 16786565..16786750 202..17 930 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:36:39 has no hits.

BO01113.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:14 Download gff for BO01113.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 1..1212 17..1226 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:10 Download gff for BO01113.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 229..1443 17..1231 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:53:37 Download gff for BO01113.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 259..1467 17..1227 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:14 Download gff for BO01113.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 229..1443 17..1231 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:22:31 Download gff for BO01113.complete
Subject Subject Range Query Range Percent Splice Strand
CG9609-RA 259..1467 17..1227 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:22:31 Download gff for BO01113.complete
Subject Subject Range Query Range Percent Splice Strand
X 16786565..16786750 17..202 100   Minus
X 16785480..16786504 203..1227 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:53:37 Download gff for BO01113.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16680598..16680783 17..202 100   Minus
arm_X 16679513..16680537 203..1227 99 <- Minus

BO01113.pep Sequence

Translation from 16 to 1243

> BO01113.pep
MPPGTQIASDSDMETALEEFKQRQGRRNSIGSAKYACSMPKCEATFKRLD
QLDRHEYHHTGIKKHACSYEGCDKTYSIVTHLKRHLRSTHERPESAAKKT
VKCALEECSKMFISVSNMTRHMRETHESPKVYPCSQCSAKFSQKLKLKRH
EIREHTLEYPYSCSKCSRGFYQQWQCQSHEPSCKLYECPGCPLQFDKWTL
YTKHCRDSLHGKNRHKCDRCDSAFDKPSELKRHLEVKHKEAAQTDECATS
FTCNEEGCGKSYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLAR
HLLRDHKDGATKKELKAKKKDKSKTGEGGKTKSTSRKRRRDAGRSKHSRL
SKLACLQLDKEDDEAVRERQPLVLEKITQSLKDDPVEELLAQTLQDEEEK
EQEASFLDH

BO01113.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:23:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG9609-PA 403 CG9609-PA 1..403 1..403 2185 100 Plus
CG32772-PE 520 CG32772-PE 132..403 38..327 279 27.4 Plus
CG32772-PC 520 CG32772-PC 132..403 38..327 279 27.4 Plus
crol-PG 878 CG14938-PG 293..583 22..309 277 29.2 Plus
CG5245-PA 501 CG5245-PA 49..322 4..306 273 26.5 Plus
crol-PG 878 CG14938-PG 353..612 27..306 265 31.1 Plus
crol-PG 878 CG14938-PG 437..644 27..241 263 31.4 Plus
crol-PG 878 CG14938-PG 221..439 65..306 155 23.6 Plus