Clone BO01115 Report

Search the DGRC for BO01115

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptAda2b-RA
Protein status:BO01115.pep:
Sequenced Size:1288

Clone Sequence Records

BO01115.3prime Sequence

826 bp (714 high quality bases) assembled on 2005-11-30

> BO01115.3prime
ATGGTCTAGAAAGCTTGCTCCAAGTAGTTTTTGCTGGGCAATAATGCGCC
GGAGCAGGTCGGGTCGGCGATGTGGAGCGTGTTTCTTGGTGCGATTGAAT
TTGAACTTGCCTCGCCGCCGCTTGACATTTCGACCTTTCTGAGATTCGGT
TGTGGGGAGTGCAAGGAAGAGCTTGGCGGCCGATGACTTCCATTGGAGGT
ATGCGTGTGGTCCTGTGGTTAAACATTGTCTTATAGAACCATTCGAACGC
TCGTTGTTTGGCGCGTTTATTATGCAGTGGAGGGTCTTGCCATGGCCATA
TGGTCCTGTAGAGCGGTGCGTCGCTGTTGCGGCGTGCTGCTCGAAATGTG
TGCATTCCGCGATTTTGGTCAGGCCATTATACCGGTATCGGTACAGCTCT
GACTGTCGAATGCGCAGTTCCTTTTCGCGCTCCAGTGATCCCAATAGCCG
CTCATACTCGTTACACGTGTAGAACTGGGCGTAGACCCGAAATCTGTCCC
GAAACTCGCGCTGCTCCTTGGTGAGTCCTTGTTGCTGAGCGTAATTTCTG
TTTCGGAAGAAATTTGATACTAATTGATAGTCCCTGACCATCCGTTTCCT
GCGAGCACGCTCTCTGAGTCGGCGGGTGTATATGTCAACGTGGGCCAGCT
TAAGCATCACATCCACCTCCGTATCCTCGGAGCTTAATGAGATGTTCGAG
ATCAGTTGCTCTGCCGTGGGATCGTACTCCCGCTCAAAGCTGTCCCTGTT
GGGCATGTAGCCCAGCTGCATGGCCTCATCGGAGTTGATTTCCAGTGGAG
GCAAGGTAGAGAGAGCATTGGTGCCC

BO01115.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9638-PA 1257 Ada2b-RA 447..1254 826..19 4040 100 Minus
CG9638-PB 1668 Ada2b-RB 447..990 826..283 2720 100 Minus
CG9638-PB 1668 Ada2b-RB 991..1184 212..19 970 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-RC 2636 CG9638-RC 539..1346 826..19 4040 100 Minus
Ada2b-RA 2154 CG9638-RA 539..1346 826..19 4040 100 Minus
Ada2b-RB 2084 CG9638-RB 539..1082 826..283 2720 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8238731..8239274 283..826 2720 100 Plus
3R 32079331 3R 8238103..8238252 133..282 750 100 Plus
3R 32079331 3R 8237922..8238035 19..132 570 100 Plus
Blast to na_te.dros performed on 2015-02-04 18:44:38 has no hits.

BO01115.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:36 Download gff for BO01115.3prime
Subject Subject Range Query Range Percent Splice Strand
Ada2b-PA 447..1257 18..826 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:56 Download gff for BO01115.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9638-PA 447..1257 18..826 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:11:10 Download gff for BO01115.3prime
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 539..1354 9..826 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:26:13 Download gff for BO01115.3prime
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 539..1354 9..826 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:26:13 Download gff for BO01115.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 8238731..8239274 283..826 100   Plus
3R 8238103..8238252 133..282 100 <- Plus
3R 8237914..8238035 9..132 96 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:11:10 Download gff for BO01115.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4064453..4064996 283..826 100   Plus
arm_3R 4063825..4063974 133..282 100 <- Plus
arm_3R 4063636..4063757 9..132 96 <- Plus

BO01115.5prime Sequence

767 bp (765 high quality bases) assembled on 2005-11-30

> BO01115.5prime
GAAGTTATCAGTCGACATGACCACAATCGCGGATTTATTCACAAAGTATA
ATTGCACAAATTGCCAGGATGATATTCAGGGCATTCGAGTGCACTGCGCG
GAGTGCGAAAACTTCGATTTGTGTCTGCAATGCTTTGCCGCAGGTGCGGA
GATCGGCGCCCATCAAAACAACCACTCCTACCAGTTCATGGACACCGGCA
CTTCCATATTGAGTGTATTTCGTGGAAAGGGGGCGTGGACGGCACGAGAG
GAAATCCGCCTGTTGGATGCAATCGAGCAGTACGGCTTTGGAAACTGGGA
GGACATTAGCAAGCACATTGAGACGAAGTCAGCGGAGGATGCCAAAGAGG
AGTACGTGAATAAGTTTGTAAATGGCACGATTGGAAGGGCCACTTGGACG
CCGGCCCAGAGCCAGAGACCCCGCCTTATCGATCACACTGGAGACGACGA
CGCTGGTCCTCTGGGCACCAATGCTCTCTCTACCTTGCCTCCACTGGAAA
TCAACTCCGATGAGGCCATGCAGCTGGGCTACATGCCCAACAGGGACAGC
TTTGAGCGGGAGTACGATCCCACGGCAGAGCAACTGATCTCGAACATCTC
ATTAAGCTCCGAGGATACGGAGGTGGATGTGATGCTTAAGCTGGCCCACG
TTGACATATACACCCGCCGACTCAGAGAGCGTGCTCGCAGGANACGGATG
GTCAGGGACTATCAATTAGTATCAAATTTCTTCCGAAACAGAAATTACGC
TCAGCAACAAGGACTCA

BO01115.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9638-PA 1257 Ada2b-RA 1..751 17..767 3736 99.8 Plus
CG9638-PB 1668 Ada2b-RB 1..751 17..767 3736 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-RC 2636 CG9638-RC 93..843 17..767 3744 99.9 Plus
Ada2b-RB 2084 CG9638-RB 93..843 17..767 3744 99.9 Plus
Ada2b-RA 2154 CG9638-RA 93..843 17..767 3744 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8238970..8239610 767..127 3179 99.7 Minus
3R 32079331 3R 8240310..8240423 130..17 570 100 Minus
Blast to na_te.dros performed on 2015-02-11 15:30:52 has no hits.

BO01115.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:37 Download gff for BO01115.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9638-PB 1..750 17..766 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:17:58 Download gff for BO01115.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9638-PB 1..750 17..766 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:47:08 Download gff for BO01115.5prime
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 93..842 17..766 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:08:39 Download gff for BO01115.5prime
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 93..842 17..766 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:08:39 Download gff for BO01115.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 8240310..8240423 17..130 100   Minus
3R 8238971..8239606 131..766 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:47:08 Download gff for BO01115.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4066032..4066145 17..130 100   Minus
arm_3R 4064693..4065328 131..766 99 <- Minus

BO01115.complete Sequence

1288 bp (1288 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629427

> BO01115.complete
GAAGTTATCAGTCGACATGACCACAATCGCGGATTTATTCACAAAGTATA
ATTGCACAAATTGCCAGGATGATATTCAGGGCATTCGAGTGCACTGCGCG
GAGTGCGAAAACTTCGATTTGTGTCTGCAATGCTTTGCCGCAGGTGCGGA
GATCGGCGCCCATCAAAACAACCACTCCTACCAGTTCATGGACACCGGCA
CTTCCATATTGAGTGTATTTCGTGGAAAGGGGGCGTGGACGGCACGAGAG
GAAATCCGCCTGTTGGATGCAATCGAGCAGTACGGCTTTGGAAACTGGGA
GGACATTAGCAAGCACATTGAGACGAAGTCAGCGGAGGATGCCAAAGAGG
AGTACGTGAATAAGTTTGTAAATGGCACGATTGGAAGGGCCACTTGGACG
CCGGCCCAGAGCCAGAGACCCCGCCTTATCGATCACACTGGAGACGACGA
CGCTGGTCCTCTGGGCACCAATGCTCTCTCTACCTTGCCTCCACTGGAAA
TCAACTCCGATGAGGCCATGCAGCTGGGCTACATGCCCAACAGGGACAGC
TTTGAGCGGGAGTACGATCCCACGGCAGAGCAACTGATCTCGAACATCTC
ATTAAGCTCCGAGGATACGGAGGTGGATGTGATGCTTAAGCTGGCCCACG
TTGACATATACACCCGCCGACTCAGAGAGCGTGCTCGCAGGAAACGGATG
GTCAGGGACTATCAATTAGTATCAAATTTCTTCCGAAACAGAAATTACGC
TCAGCAACAAGGACTCACCAAGGAGCAGCGCGAGTTTCGGGACAGATTTC
GGGTCTACGCCCAGTTCTACACGTGTAACGAGTATGAGCGGCTATTGGGA
TCACTGGAGCGCGAAAAGGAACTGCGCATTCGACAGTCAGAGCTGTACCG
ATACCGGTATAATGGCCTGACCAAAATCGCGGAATGCACACATTTCGAGC
AGCACGCCGCAACAGCGACGCACCGCTCTACAGGACCATATGGCCATGGC
AAGACCCTCCACTGCATAATAAACGCGCCAAACAACGAGCGTTCGAATGG
TTCTATAAGACAATGTTTAACCACAGGACCACACGCATACCTCCAATGGA
AGTCATCGGCCGCCAAGCTCTTCCTTGCACTCCCCACAACCGAATCTCAG
AAAGGTCGAAATGTCAAGCGGCGGCGAGGCAAGTTCAAATTCAATCGCAC
CAAGAAACACGCTCCACATCGCCGACCCGACCTGCTCCGGCGCATTATTG
CCCAGCAAAAACTACTTGGAGCAAGCTTTCTAGACCAT

BO01115.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-RC 1257 CG9638-PC 1..1254 17..1270 6270 100 Plus
Ada2b-RA 1257 CG9638-PA 1..1254 17..1270 6270 100 Plus
Ada2b-RB 1668 CG9638-PB 1..990 17..1006 4950 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:55:45
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-RC 2636 CG9638-RC 93..1346 17..1270 6270 100 Plus
Ada2b-RA 2154 CG9638-RA 93..1346 17..1270 6270 100 Plus
Ada2b-RB 2084 CG9638-RB 93..1082 17..1006 4950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8238731..8239610 1006..127 4385 99.9 Minus
3R 32079331 3R 8238103..8238252 1156..1007 750 100 Minus
3R 32079331 3R 8237922..8238035 1270..1157 570 100 Minus
3R 32079331 3R 8240310..8240423 130..17 570 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:55:42 has no hits.

BO01115.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:15 Download gff for BO01115.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 1..1257 17..1271 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:11 Download gff for BO01115.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 90..1351 17..1280 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:28:50 Download gff for BO01115.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 93..1346 17..1272 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:15 Download gff for BO01115.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 90..1351 17..1280 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:59:16 Download gff for BO01115.complete
Subject Subject Range Query Range Percent Splice Strand
Ada2b-RA 93..1346 17..1272 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:59:16 Download gff for BO01115.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8240310..8240423 17..130 100   Minus
3R 8238731..8239606 131..1006 100 <- Minus
3R 8238103..8238252 1007..1156 100 <- Minus
3R 8237918..8238035 1157..1272 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:28:50 Download gff for BO01115.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4066032..4066145 17..130 100   Minus
arm_3R 4064453..4065328 131..1006 100 <- Minus
arm_3R 4063825..4063974 1007..1156 100 <- Minus
arm_3R 4063640..4063757 1157..1272 98 <- Minus

BO01115.pep Sequence

Translation from 16 to 1288

> BO01115.pep
MTTIADLFTKYNCTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQ
NNHSYQFMDTGTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKH
IETKSAEDAKEEYVNKFVNGTIGRATWTPAQSQRPRLIDHTGDDDAGPLG
TNALSTLPPLEINSDEAMQLGYMPNRDSFEREYDPTAEQLISNISLSSED
TEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSNFFRNRNYAQQQGL
TKEQREFRDRFRVYAQFYTCNEYERLLGSLEREKELRIRQSELYRYRYNG
LTKIAECTHFEQHAATATHRSTGPYGHGKTLHCIINAPNNERSNGSIRQC
LTTGPHAYLQWKSSAAKLFLALPTTESQKGRNVKRRRGKFKFNRTKKHAP
HRRPDLLRRIIAQQKLLGASFLDH

BO01115.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Ada2b-PC 418 CG9638-PC 1..418 1..418 2220 100 Plus
Ada2b-PA 418 CG9638-PA 1..418 1..418 2220 100 Plus
Ada2b-PB 555 CG9638-PB 1..341 1..348 1762 96.6 Plus
Ada2a-PG 527 CG43663-PG 81..379 13..305 245 26.3 Plus
Ada2a-PC 527 CG43663-PC 81..379 13..305 245 26.3 Plus