Clone BO01118 Report

Search the DGRC for BO01118

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptCG9797-RA
Protein status:BO01118.pep: full length peptide match
Sequenced Size:1288

Clone Sequence Records

BO01118.3prime Sequence

875 bp (801 high quality bases) assembled on 2005-11-30

> BO01118.3prime
ATGGTCTAGAAAGCTTGCGATGTGCAGGCTGTCCTCCTCCTCCTCCTTGA
GTTCACGTTTCTGCTCCTGCTCCAGGACCTGTTTCATCTCGGCTTTCTCC
AGATGCCGCTTGTGTACGCCAGACCGGAAGTGGGTGCTCAGGTGGGTGGG
CAGCATAAAGGACTTGTCGCACAGCTCGCACCTGTAGGCCCGCTCGCCGG
AATGTATCAGCATATGGTTCTTAAGGATGTAGCCGGTAGTGAAGGCCTTG
CCGCAAGTACCACAGACGTAGGGGCGCTCATTGGTGTGGGTACGCTCATG
CTTCACGCGCGTGGTGTAGTCTGTGAAGCAGCGGCCACAGTACTTACATG
CAAACGGTCGCTCTCCGGTGTGCTTGCGCATGTGGCGTTTCAGCTCGGAA
GTTGTGCAGAAGCGCGACTGACAGAGTTCGCAGCCAAATTGCTTGTCCCC
ACGATGGCGACGACAGTGAAGTTCAAAGGCCATGCGTCCCTTGATGTGAT
TGCCGCACTGCTCGCAGATGTATACTCCGCCGGTGCCACGACGACGCGCA
TCATCCGACCGGACCTTTGGCTTTGGCGGCAGACTACACTTCTTGACGAC
AATGTTTTCATGCTCGTACTCATCATCCAGCACGTTGTCAAGAACGGCCA
CCTCATCATCCGAATCGTAGACGTACGCGTCGTTGACGTCGCCCACAATT
AGCTCGGTGTCTTCGTCCAGCTCCAACGTTTGCTGCTGCTCTTCGTCTTC
GGCCATTATGGAATCATAGTCGGCCTCTTCAATCAAGGAGGCTGCGTCGT
CCTCGCCGGCGTGTCCCTCGGCCACCTCGTAGTAGGTATTATCGTACTCT
ACCTTGGTGTCGTCGATCTCTTCCT

BO01118.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG9797-PA 1257 CG9797-RA 398..1254 875..19 4285 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
M1BP-RA 1519 CG9797-RA 514..1377 875..12 4290 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8730670..8731117 428..875 2240 100 Plus
3R 32079331 3R 8730365..8730612 180..427 1240 100 Plus
3R 32079331 3R 8729932..8730103 12..183 830 98.8 Plus
Blast to na_te.dros performed on 2015-02-11 23:57:13 has no hits.

BO01118.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:42 Download gff for BO01118.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9797-PA 398..1257 15..875 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:06 Download gff for BO01118.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9797-PA 398..1257 15..875 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:31:05 Download gff for BO01118.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 514..1380 9..875 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:58:37 Download gff for BO01118.3prime
Subject Subject Range Query Range Percent Splice Strand
M1BP-RA 514..1380 9..875 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:58:37 Download gff for BO01118.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 8730670..8731117 428..875 100   Plus
3R 8730367..8730612 182..427 100 <- Plus
3R 8729929..8730101 9..181 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:31:05 Download gff for BO01118.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4556392..4556839 428..875 100   Plus
arm_3R 4556089..4556334 182..427 100 <- Plus
arm_3R 4555651..4555823 9..181 98 <- Plus

BO01118.5prime Sequence

817 bp (814 high quality bases) assembled on 2005-11-30

> BO01118.5prime
GAAGTTATCAGTCGACATGTCGAAATCGGCGCTGAAACACCTAAAGAGCA
CCTGCCGCGTATGCGCAAAGTATGCAAGCAACAAGCGGTCGCCGAAGTTA
TTCGAGCGGAGCAACACAAAGATGATCGACAACATTGAGGCGCTCACAGG
CCTTCGGCTGGAGAACTACGGTTGCCTGCCGGATCAGATATGTGAATGCT
GCAGCATGGAACTGGCCTCCGCCGTTAAGCTGAGGGAGCGCTGCATCGCC
GCCCAGCGTGAGCTACTCTTGGGATTGACCGAGGAGCAACGCCAAGGCAT
CTCGGCCTTCTACCGGGCGGCTGTCATGGGCGAGGATATTGTCCAGACGG
TGAAGACGCCCGACGATGATGAGGTCTATGCCACTTATCAGGAAATCGTA
TTGGAAGAACCTAAGGAAGAGATCGACGACACCAAGGTAGAGTACGATAA
TACCTACTACGAGGTGGCCGAGGGACACGCCGGCGAGGACGACGCAGCCT
CCTTGATTGAAGAGGCCGACTATGATTCCATAATGGCCGAAGACGAAGAG
CAGCAGCAAACGTTGGAGCTGGACGAAGACACCGAGCTAATTGTGGGCGA
CGTCAACGACGCGTACGTCTACGATTCGGATGATGAGGTGGCCGTTCTTG
ACAACGTGCTGGATGATGAGTACGAGCATGAAAACATTGTCGTCAAGAAG
TGTAGTCTGCCGCCAAAGCCAAAGGTCCGGTCGGATGATGCGCGTCGTCG
TGGCACCGGCGGAGTATACATCTGCGAGCAGTGCGGCAATCACATCAAGG
GACGCATGGCCTTTGAA

BO01118.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG9797-PA 1257 CG9797-RA 1..801 17..817 4005 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
M1BP-RA 1519 CG9797-RA 117..917 17..817 4005 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8730714..8731374 817..157 3305 100 Minus
3R 32079331 3R 8731442..8731582 157..17 705 100 Minus
Blast to na_te.dros performed on 2015-02-11 15:31:22 has no hits.

BO01118.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:43 Download gff for BO01118.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9797-PA 1..799 17..815 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:07 Download gff for BO01118.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9797-PA 1..799 17..815 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:47:10 Download gff for BO01118.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 117..917 17..817 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:09:53 Download gff for BO01118.5prime
Subject Subject Range Query Range Percent Splice Strand
M1BP-RA 117..917 17..817 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:09:53 Download gff for BO01118.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 8731442..8731582 17..157 100   Minus
3R 8730714..8731373 158..817 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:47:10 Download gff for BO01118.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4557164..4557304 17..157 100   Minus
arm_3R 4556436..4557095 158..817 100 <- Minus

BO01118.complete Sequence

1288 bp (1288 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629428

> BO01118.complete
GAAGTTATCAGTCGACATGTCGAAATCGGCGCTGAAACACCTAAAGAGCA
CCTGCCGCGTATGCGCAAAGTATGCAAGCAACAAGCGGTCGCCGAAGTTA
TTCGAGCGGAGCAACACAAAGATGATCGACAACATTGAGGCGCTCACAGG
CCTTCGGCTGGAGAACTACGGTTGCCTGCCGGATCAGATATGTGAATGCT
GCAGCATGGAACTGGCCTCCGCCGTTAAGCTGAGGGAGCGCTGCATCGCC
GCCCAGCGTGAGCTACTCTTGGGATTGACCGAGGAGCAACGCCAAGGCAT
CTCGGCCTTCTACCGGGCGGCTGTCATGGGCGAGGATATTGTCCAGACGG
TGAAGACGCCCGACGATGATGAGGTCTATGCCACTTATCAGGAAATCGTA
TTGGAAGAACCTAAGGAAGAGATCGACGACACCAAGGTAGAGTACGATAA
TACCTACTACGAGGTGGCCGAGGGACACGCCGGCGAGGACGACGCAGCCT
CCTTGATTGAAGAGGCCGACTATGATTCCATAATGGCCGAAGACGAAGAG
CAGCAGCAAACGTTGGAGCTGGACGAAGACACCGAGCTAATTGTGGGCGA
CGTCAACGACGCGTACGTCTACGATTCGGATGATGAGGTGGCCGTTCTTG
ACAACGTGCTGGATGATGAGTACGAGCATGAAAACATTGTCGTCAAGAAG
TGTAGTCTGCCGCCAAAGCCAAAGGTCCGGTCGGATGATGCGCGTCGTCG
TGGCACCGGCGGAGTATACATCTGCGAGCAGTGCGGCAATCACATCAAGG
GACGCATGGCCTTTGAACTTCACTGTCGTCGCCATCGTGGGGACAAGCAA
TTTGGCTGCGAACTCTGTCAGTCGCGCTTCTGCACAACTTCCGAGCTGAA
ACGCCACATGCGCAAGCACACCGGAGAGCGACCGTTTGCATGTAAGTACT
GTGGCCGCTGCTTCACAGACTACACCACGCGCGTGAAGCATGAGCGTACC
CACACCAATGAGCGCCCCTACGTCTGTGGTACTTGCGGCAAGGCCTTCAC
TACCGGCTACATCCTTAAGAACCATATGCTGATACATTCCGGCGAGCGGG
CCTACAGGTGCGAGCTGTGCGACAAGTCCTTTATGCTGCCCACCCACCTG
AGCACCCACTTCCGGTCTGGCGTACACAAGCGGCATCTGGAGAAAGCCGA
GATGAAACAGGTCCTGGAGCAGGAGCAGAAACGTGAACTCAAGGAGGAGG
AGGAGGACAGCCTGCACATCGCAAGCTTTCTAGACCAT

BO01118.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
M1BP-RA 1257 CG9797-PA 1..1254 17..1270 6270 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
M1BP-RA 1519 CG9797-RA 117..1377 17..1277 6275 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8730670..8731374 861..157 3525 100 Minus
3R 32079331 3R 8730365..8730612 1109..862 1240 100 Minus
3R 32079331 3R 8729932..8730103 1277..1106 830 98.8 Minus
3R 32079331 3R 8731442..8731582 157..17 705 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:52:33 has no hits.

BO01118.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:02 Download gff for BO01118.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 1..1257 17..1274 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:52 Download gff for BO01118.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 113..1376 17..1280 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:01:23 Download gff for BO01118.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 117..1370 17..1272 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:02 Download gff for BO01118.complete
Subject Subject Range Query Range Percent Splice Strand
CG9797-RA 113..1376 17..1280 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:28:13 Download gff for BO01118.complete
Subject Subject Range Query Range Percent Splice Strand
M1BP-RA 117..1370 17..1272 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:28:13 Download gff for BO01118.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8731442..8731582 17..157 100   Minus
3R 8730670..8731373 158..861 100 <- Minus
3R 8730367..8730612 862..1107 100 <- Minus
3R 8729937..8730101 1108..1272 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:01:23 Download gff for BO01118.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4557164..4557304 17..157 100   Minus
arm_3R 4556392..4557095 158..861 100 <- Minus
arm_3R 4556089..4556334 862..1107 100 <- Minus
arm_3R 4555659..4555823 1108..1272 98 <- Minus

BO01118.pep Sequence

Translation from 16 to 1288

> BO01118.pep
MSKSALKHLKSTCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLEN
YGCLPDQICECCSMELASAVKLRERCIAAQRELLLGLTEEQRQGISAFYR
AAVMGEDIVQTVKTPDDDEVYATYQEIVLEEPKEEIDDTKVEYDNTYYEV
AEGHAGEDDAASLIEEADYDSIMAEDEEQQQTLELDEDTELIVGDVNDAY
VYDSDDEVAVLDNVLDDEYEHENIVVKKCSLPPKPKVRSDDARRRGTGGV
YICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRK
HTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYIL
KNHMLIHSGERAYRCELCDKSFMLPTHLSTHFRSGVHKRHLEKAEMKQVL
EQEQKRELKEEEEDSLHIASFLDH

BO01118.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
M1BP-PA 418 CG9797-PA 1..418 1..418 2234 100 Plus
ranshi-PA 346 CG9793-PA 6..340 13..395 758 39.8 Plus
CG8159-PB 399 CG8159-PB 2..335 9..394 636 34.7 Plus
CG11762-PA 312 CG11762-PA 2..309 9..393 561 33.2 Plus
CG18764-PA 409 CG18764-PA 5..395 13..387 504 31.5 Plus