Clone BO01120 Report

Search the DGRC for BO01120

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptCG17806-RA
Protein status:BO01120.pep:
Sequenced Size:1297

Clone Sequence Records

BO01120.3prime Sequence

898 bp (808 high quality bases) assembled on 2005-11-30

> BO01120.3prime
ATGGTCTAGAAAGCTTGCCCCATCCGCTTGGACAGTAGCATCCATTTTTG
GCATTTTTGACTGCTCCTCAACTTTCAGGCGATGGTGCTTCGACTTGTAG
TGGGTGGCCAGGGCGTTCCTTCTATTGAAGAACGTTTGGCAGAGCTCGCA
GTGGAATGGCTGTTCCCCCGTGTGGACCACGATGTGGTCCTTGAGAGCCG
TCGAAGTCTTGAAGGCCTTCTGGCATGTGGAGCACACGTGTGGTCGGTGG
ACGGGACTCTCCTTGTGGTTGCGCTCGTGGTTCAGCCGCTTGAGGCAGTT
GTCAAATCGCTTGCCGCAGTACTTGCACACGTAGGGCAGCTCCCCGCGAT
GCTTAATCCGCACGTGCAAATTGAGCAGGTGTTGGGTGAACTCCATGCGG
TCGCACTCCTGGCACTGGAACTCCTTGGTGCCCTTGTGCCGTCTGAGGTG
CACATTGAAGTTGCCCTTCTCGCTAAAAGTTTTGCCGCATTGGTCGCAGA
AATATAGTCGGTGCTCCAGTGCATAGGCTCTTTTGGCAGCTCCCCATTTG
TTTCGTGTGGCATACTTTTCCTCTTTGGTCTTATTGGTAGTTGAGTCAAT
ATTCTCTATTTTAGCCATGTCCTTGCCAGGACACTCCTCTAAGCACCCTT
TGCTCCTCGGTTTTCTTCGGTTTTTCTGTACTTCCCCGATGACTTGTAGT
GTTCTGGGCTCTTCCTTCATGACTTGNGGCATTTCGGATGCTGGCTCTTC
GTGATTCATGGACTCCACTGGATAATCAGATGAAAGCTGAGGCTCGCTCT
TCACCTGAATAGGATCCTCGCACCGGAGAGGATCGACGAGATCGGCAGGC
GGGTATTTCGGGGACAACTAAAGGGTAAATTGGGGGTTTCTACTGTCT

BO01120.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-PA 1266 CG17806-RA 430..1263 852..19 4151 99.8 Minus
CG17806-PA 1266 CG17806-RA 398..431 885..852 145 97 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-RA 1613 CG17806-RA 480..1357 898..19 4324 99.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17801987..17802731 152..898 3609 99.5 Plus
3R 32079331 3R 17801798..17801930 19..151 665 100 Plus
Blast to na_te.dros performed on 2015-02-12 23:43:59 has no hits.

BO01120.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:44 Download gff for BO01120.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17806-PA 386..1266 15..898 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:08 Download gff for BO01120.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17806-PA 386..1266 15..898 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:20:40 Download gff for BO01120.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 480..1366 10..898 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:29:14 Download gff for BO01120.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 480..1366 10..898 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:29:14 Download gff for BO01120.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 17801987..17802731 152..898 99   Plus
3R 17801789..17801930 10..151 97 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:20:40 Download gff for BO01120.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13627709..13628453 152..898 99   Plus
arm_3R 13627511..13627652 10..151 97 <- Plus

BO01120.5prime Sequence

726 bp (725 high quality bases) assembled on 2005-11-30

> BO01120.5prime
GAAGTTATCAGTCGACATGACCACGCTGTGCCGCACCTGTGGCCAGGAGG
CGGAGCACGCCAAGTCACTTTTCGATAAGGAGGCCAGAGATGTCCTGAGC
AACATCCTCAAGCTGACGGGCTTTTGGTTGAGGAACCAGCCAGGTGTGCC
AACGAGGATCTGCTTATCCTGCTTGCTGGATCTGAACGATGCCATCGCAT
TCCGGGAGCGCTGCATCAGGACCAATTCGTCTTGGTTCGAAAAGCAGGGC
AAACAAGAGGATTCGGACACTGAGACTGCAAGGGAAGGCGGGAATAACAG
GTTAGAAAGTAGGGTGGATGTTATGCCCATTAGTATTGCACAGCCGCAAA
GGAGAAGGATTCTACCACAACGCAGCAAGAAAGTGGATGGAGTGCCTCTT
AAGACAGTAGAAACCCCAATTTACCCTTTAGTTGTCCCGGAAATACCGCC
TGCCGATCTCGTCGATCCTCTCCGGTGCGAGGATCCTATTCAGGTGAAGA
GCGAGCCTCAGCTTTCATCTGATTATCCAGTGGAGTCCATGAATCACGAA
GAGCCAGCATCCGAAATGCCCCAAGTCATGAAGGAAGAGCCCAGAACACT
ACAAGTCATCGGGGAAGTACAGAAAAACCGAAGAAAACCGAGGAGCAAAG
GGTGCTTAGAGGAGTGTCCTGGCAAGGACATGGCTAANATAGAGAATATT
GACTCAACTACCAATAAGACCAAAGA

BO01120.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-PA 1266 CG17806-RA 1..710 17..726 3531 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-RA 1613 CG17806-RA 95..804 17..726 3539 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17802407..17803006 726..127 2989 99.8 Minus
3R 32079331 3R 17803056..17803166 127..17 555 100 Minus
Blast to na_te.dros performed on 2015-02-13 13:17:39 has no hits.

BO01120.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:45 Download gff for BO01120.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17806-PA 1..709 17..725 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:10 Download gff for BO01120.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17806-PA 1..709 17..725 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:33:12 Download gff for BO01120.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 92..803 10..725 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:36:36 Download gff for BO01120.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 92..803 10..725 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:36:36 Download gff for BO01120.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 17803056..17803169 10..127 96   Minus
3R 17802408..17803005 128..725 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:33:12 Download gff for BO01120.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13628778..13628891 10..127 96   Minus
arm_3R 13628130..13628727 128..725 99 <- Minus

BO01120.complete Sequence

1297 bp (1297 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629429

> BO01120.complete
GAAGTTATCAGTCGACATGACCACGCTGTGCCGCACCTGTGGCCAGGAGG
CGGAGCACGCCAAGTCACTTTTCGATAAGGAGGCCAGAGATGTCCTGAGC
AACATCCTCAAGCTGACGGGCTTTTGGTTGAGGAACCAGCCAGGTGTGCC
AACGAGGATCTGCTTATCCTGCTTGCTGGATCTGAACGATGCCATCGCAT
TCCGGGAGCGCTGCATCAGGACCAATTCGTCTTGGTTCGAAAAGCAGGGC
AAACAAGAGGATTCGGACACTGAGACTGCAAGGGAAGGCGGGAATAACAG
GTTAGAAAGTAGGGTGGATGTTATGCCCATTAGTATTGCACAGCCGCAAA
GGAGAAGGATTCTACCACAACGCAGCAAGAAAGTGGATGGAGTGCCTCTT
AAGACAGTAGAAACCCCAATTTACCCTTTAGTTGTCCCGGAAATACCGCC
TGCCGATCTCGTCGATCCTCTCCGGTGCGAGGATCCTATTCAGGTGAAGA
GCGAGCCTCAGCTTTCATCTGATTATCCAGTGGAGTCCATGAATCACGAA
GAGCCAGCATCCGAAATGCCCCAAGTCATGAAGGAAGAGCCCAGAACACT
ACAAGTCATCGGGGAAGTACAGAAAAACCGAAGAAAACCGAGGAGCAAAG
GGTGCTTAGAGGAGTGTCCTGGCAAGGACATGGCTAAAATAGAGAATATT
GACTCAACTACCAATAAGACCAAAGAGGAAAAGTATGCCACACGAAACAA
ATGGGGAGCTGCCAAAAGAGCCTATGCACTGGAGCACCGACTATATTTCT
GCGACCAATGCGGCAAAACTTTTAGCGAGAAGGGCAACTTCAATGTGCAC
CTCAGACGGCACAAGGGCACCAAGGAGTTCCAGTGCCAGGAGTGCGACCG
CATGGAGTTCACCCAACACCTGCTCAATTTGCACGTGCGGATTAAGCATC
GCGGGGAGCTGCCCTACGTGTGCAAGTACTGCGGCAAGCGATTTGACAAC
TGCCTCAAGCGGCTGAACCACGAGCGCAACCACAAGGAGAGTCCCGTCCA
CCGACCACACGTGTGCTCCACATGCCAGAAGGCCTTCAAGACTTCGACGG
CTCTCAAGGACCACATCGTGGTCCACACGGGGGAACAGCCATTCCACTGC
GAGCTCTGCCAAACGTTCTTCAATAGAAGGAACGCCCTGGCCACCCACTA
CAAGTCGAAGCACCATCGCCTGAAAGTTGAGGAGCAGTCAAAAATGCCAA
AAATGGATGCTACTGTCCAAGCGGATGGGGCAAGCTTTCTAGACCAT

BO01120.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-RA 1266 CG17806-PA 1..1263 17..1279 6315 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-RA 1613 CG17806-RA 95..1357 17..1279 6315 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17801987..17803006 1146..127 5100 100 Minus
3R 32079331 3R 17801798..17801930 1279..1147 665 100 Minus
3R 32079331 3R 17803056..17803166 127..17 555 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:40:14 has no hits.

BO01120.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:03 Download gff for BO01120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 1..1266 17..1283 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:54 Download gff for BO01120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 61..1335 10..1288 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:31:06 Download gff for BO01120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 95..1357 17..1281 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:03 Download gff for BO01120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 61..1335 10..1288 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:50 Download gff for BO01120.complete
Subject Subject Range Query Range Percent Splice Strand
CG17806-RA 95..1357 17..1281 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:27:50 Download gff for BO01120.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17803056..17803166 17..127 100   Minus
3R 17801987..17803005 128..1146 100 <- Minus
3R 17801796..17801930 1147..1281 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:31:06 Download gff for BO01120.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13628778..13628888 17..127 100   Minus
arm_3R 13627709..13628727 128..1146 100 <- Minus
arm_3R 13627518..13627652 1147..1281 98 <- Minus

BO01120.pep Sequence

Translation from 16 to 1297

> BO01120.pep
MTTLCRTCGQEAEHAKSLFDKEARDVLSNILKLTGFWLRNQPGVPTRICL
SCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRV
DVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLVVPEIPPADLVD
PLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIGE
VQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAK
RAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQ
HLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVC
STCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHH
RLKVEEQSKMPKMDATVQADGASFLDH

BO01120.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG17806-PA 421 CG17806-PA 1..421 1..421 2276 100 Plus
CG17802-PA 439 CG17802-PA 1..436 1..415 510 29.8 Plus
CG18764-PA 409 CG18764-PA 1..400 1..405 468 30 Plus
ranshi-PA 346 CG9793-PA 5..338 4..406 446 29.1 Plus
CG8159-PB 399 CG8159-PB 2..334 1..406 428 28.3 Plus