Clone BO01121 Report

Search the DGRC for BO01121

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:21
Vector:pDNR-Dual
Associated Gene/Transcriptvis-RA
Protein status:BO01121.pep:
Sequenced Size:1306

Clone Sequence Records

BO01121.3prime Sequence

891 bp (779 high quality bases) assembled on 2005-11-30

> BO01121.3prime
ATGGTCTAGAAAGCTTGCGTCTCCCATGTAAACGAAATCGTCATCCTGGA
CGTCATCGTTTTGGCGCACAGCCATGGCAGTTTCCACTAGATAATAGAGA
CACTTGTACTTGCCCTCCTCATCTGAACTGGTGCCCTGCGATAGAGCAGA
TAATTGACTCTGGCCAGCTTCTGCTTCGGCACCGGTAAACACCTCGTCCG
CCTGTAGATTGTCACCAATGTCCTGTTGATTGGAGTTGGTAGGATCGATT
GTCTGGATTTCTGAGGCCTGTATTATATTCAGCTCGCTTTCAAAGTCTGT
CAACTGTTGATTCACGTCACGCTTCGCAGTCTGATTGCGATTCCAGATGG
CGGTATTCTGAACAGATGCCTTAGAACCAGAGGTACCTGGATTATTGCCA
GCCGAAGTGCTGACTTCCTCAGTCCCAAATACAGTTTTTATAACGCTCTG
CCAATCATGGGAGGTCTCGAAGCGTACTTCCTCCTCGCTGTTCGGCCCAC
AGGACTCGTATCCCTGTGCACTCTCTTCGCCTTCGGACCTGTAGATGACA
CTGTCCTCGTACTCCGGCTCCATCTTGACCATTTGTCCGTTGGGGCCCTG
CACATACTGTTCAAAGTTGGTCAGCACATTGGCGATGCCCTCGTGAATCT
CACCGGCGCCATCCACCTCCTCTGTAGCGCCAACGACCACTTCGGAAGCA
GGACTTCCGTGTGCGGGATTCGGCCCAGTCAAGTTTGCGCCCAACGCACT
TGATCTCGAACAGTTGGGGCTAACCTTTTTGCCACGTCGCGATATGGTGA
AGTGCAGAGGATCGTTGCCCTCGCGCCTGATCATCTCGGGTAGAATGCGG
CGACGGGCATTGATGAACCAGTTGCACACTTGGGAGCACGT

BO01121.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8821-PA 1275 vis-RA 408..1272 883..19 4325 100 Minus
CG8819-PA 1281 achi-RA 414..1179 883..118 3605 98.8 Minus
CG8821-PB 1575 vis-RB 1051..1572 540..19 2610 100 Minus
CG8819-PC 1668 achi-RC 1144..1566 540..118 1915 98.1 Minus
CG8819-PC 1668 achi-RC 414..758 883..539 1700 99.7 Minus
CG8821-PB 1575 vis-RB 516..665 688..539 750 100 Minus
CG8821-PB 1575 vis-RB 408..518 883..773 555 100 Minus
CG8819-PC 1668 achi-RC 1572..1665 112..19 470 100 Minus
CG8819-PA 1281 achi-RA 1185..1278 112..19 470 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
vis-RA 1741 CG8821-RA 496..1365 889..19 4330 99.9 Minus
achi-RA 2122 CG8819-RA 713..1582 889..19 4135 98.4 Minus
vis-RB 2124 CG8821-RB 1227..1748 540..19 2610 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12509777..12509974 686..883 990 100 Plus
2R 25286936 2R 12513566..12513763 686..883 975 99.5 Plus
2R 25286936 2R 12508465..12508646 134..315 910 100 Plus
2R 25286936 2R 12512254..12512435 134..315 850 97.8 Plus
2R 25286936 2R 12509569..12509720 537..688 760 100 Plus
2R 25286936 2R 12513358..12513509 537..688 760 100 Plus
2R 25286936 2R 12508712..12508833 315..436 610 100 Plus
2R 25286936 2R 12508272..12508388 19..135 585 100 Plus
2R 25286936 2R 12512501..12512622 315..436 580 98.4 Plus
2R 25286936 2R 12508893..12508997 437..541 525 100 Plus
2R 25286936 2R 12512682..12512786 437..541 525 100 Plus
2R 25286936 2R 12512074..12512190 19..135 495 94.9 Plus
Blast to na_te.dros performed on 2015-02-11 02:06:27 has no hits.

BO01121.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:46 Download gff for BO01121.3prime
Subject Subject Range Query Range Percent Splice Strand
vis-PA 400..1275 18..891 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:11 Download gff for BO01121.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8821-PA 400..1275 18..891 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:42:50 Download gff for BO01121.3prime
Subject Subject Range Query Range Percent Splice Strand
vis-RA 576..1454 13..891 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:19:57 Download gff for BO01121.3prime
Subject Subject Range Query Range Percent Splice Strand
vis-RA 493..1371 13..891 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:19:57 Download gff for BO01121.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12509779..12509982 688..891 99   Plus
2R 12509571..12509719 539..687 100 <- Plus
2R 12508893..12508994 437..538 100 <- Plus
2R 12508712..12508833 315..436 100 <- Plus
2R 12508466..12508645 135..314 100 <- Plus
2R 12508266..12508387 13..134 97 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:42:50 Download gff for BO01121.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8397284..8397487 688..891 99   Plus
arm_2R 8397076..8397224 539..687 100 <- Plus
arm_2R 8396398..8396499 437..538 100 <- Plus
arm_2R 8396217..8396338 315..436 100 <- Plus
arm_2R 8395971..8396150 135..314 100 <- Plus
arm_2R 8395771..8395892 13..134 97 <- Plus

BO01121.5prime Sequence

858 bp (771 high quality bases) assembled on 2005-11-30

> BO01121.5prime
GAAGTTATCAGTCGACATGATCTCGCCGGAACAAGAGGAGGTCAACATGG
TCCTGGATCGCCATGTACGGCAGAACATAAAGGACCTGATGCACGAGGCT
CATGTCCATGCGAGCCTGCTGAACAACGAGGGACGTGACCGTTTCCACTC
GGACTCCAGTTTGGACCAGGATTCCCTTCACGCCGTCGTTGGGAATGATC
TGAGCACCGAACAAGGCGCCAACCAGGTGCAAAACTACCACGACATGATG
GTGGACAGTGAACACCACGTCGACATTAATGGGTCGCTGCGCAAACGTCG
CGGAAATCTGCCCAAGTCATCTGTAAAGATTTTAAAGCGTTGGCTTTATG
AGCACCGCTATAACGCCTATCCGAGCGATGCGGAGAAGTTCACCCTGTCC
CAGGAGGCCAATCTGACGGTGCTCCAAGTGTGCAACTGGTTCATCAATGC
CCGTCGCCGCATTCTACCCGAGATGATCAGGCGCGAGGGCAACGATCCTC
TGCACTTCACCATATCGCGACGTGGCAAAAAGGTTAGCCCCAACTGTTCG
AGATCAAGTGCGTTGGGCGCAAACTTGACTGGGCCGAATCCCGCACACGG
AAGTCCTGCTTCCGAAGTGGTCGTTGGCGCTACAGAGGAGGTGGATGGCG
CCGGTGAGATTCACGAGGGCATCGCCAATGTGCTGACCAACTTTGAACAG
TATGTGCAGGGCCCCAACGGACAAATGGTCAAGATGGAGCCGGAGTACGA
GGACAGTGTCATCTACAGGTCCGAAGGCGAAGAGAGTGCACAGGGATACG
AGTCCTGTGTGCCGAACAGCGAGGAGGAAGTACGCTTCGAGACCTCCCAT
GATTGGCA

BO01121.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8821-PA 1275 vis-RA 1..842 17..858 4185 99.8 Plus
CG8819-PA 1281 achi-RA 192..848 202..858 3060 98.6 Plus
CG8819-PC 1668 achi-RC 192..758 202..768 2635 98.5 Plus
CG8821-PB 1575 vis-RB 1..518 17..534 2590 100 Plus
CG8821-PB 1575 vis-RB 516..665 619..768 750 100 Plus
CG8819-PC 1668 achi-RC 1..167 17..183 510 92.2 Plus
CG8819-PA 1281 achi-RA 1..167 17..183 510 92.2 Plus
CG8821-PB 1575 vis-RB 1051..1142 767..858 435 98.9 Plus
CG8819-PC 1668 achi-RC 1144..1235 767..858 435 98.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
vis-RA 1741 CG8821-RA 94..935 17..858 4195 99.9 Plus
achi-RA 2122 CG8819-RA 305..1152 17..858 3730 96.2 Plus
achi-RD 2277 CG8819-RD 73..830 17..768 3295 95.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12509777..12510267 621..131 2455 100 Minus
2R 25286936 2R 12513566..12514062 621..131 2090 95.2 Minus
2R 25286936 2R 12509569..12509720 770..619 760 100 Minus
2R 25286936 2R 12513358..12513509 770..619 760 100 Minus
2R 25286936 2R 12510324..12510439 132..17 580 100 Minus
2R 25286936 2R 12508905..12508997 858..766 450 98.9 Minus
2R 25286936 2R 12512694..12512786 858..766 450 98.9 Minus
2R 25286936 2R 12514132..12514244 129..17 445 92.9 Minus
Blast to na_te.dros performed on 2015-02-04 18:45:20 has no hits.

BO01121.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:47 Download gff for BO01121.5prime
Subject Subject Range Query Range Percent Splice Strand
vis-PA 1..841 17..857 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:13 Download gff for BO01121.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8821-PA 1..841 17..857 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:11:14 Download gff for BO01121.5prime
Subject Subject Range Query Range Percent Splice Strand
vis-RA 177..1017 17..857 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:26:17 Download gff for BO01121.5prime
Subject Subject Range Query Range Percent Splice Strand
vis-RA 94..934 17..857 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:26:17 Download gff for BO01121.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12510325..12510439 17..131 100   Minus
2R 12509779..12510266 132..619 100 <- Minus
2R 12509571..12509719 620..768 100 <- Minus
2R 12508906..12508994 769..857 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:11:14 Download gff for BO01121.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8397830..8397944 17..131 100   Minus
arm_2R 8397284..8397771 132..619 100 <- Minus
arm_2R 8397076..8397224 620..768 100 <- Minus
arm_2R 8396411..8396499 769..857 98 <- Minus

BO01121.complete Sequence

1306 bp (1306 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629430

> BO01121.complete
GAAGTTATCAGTCGACATGATCTCGCCGGAACAAGAGGAGGTCAACATGG
TCCTGGATCGCCATGTACGGCAGAACATAAAGGACCTGATGCACGAGGCT
CATGTCCATGCGAGCCTGCTGAACAACGAGGGACGTGACCGTTTCCACTC
GGACTCCAGTTTGGACCAGGATTCCCTTCACGCCGTCGTTGGGAATGATC
TGAGCACCGAACAAGGCGCCAACCAGGTGCAAAACTACCACGACATGATG
GTGGACAGTGAACACCACGTCGACATTAATGGGTCGCTGCGCAAACGTCG
CGGAAATCTGCCCAAGTCATCTGTAAAGATTTTAAAGCGTTGGCTTTATG
AGCACCGCTATAACGCCTATCCGAGCGATGCGGAGAAGTTCACCCTGTCC
CAGGAGGCCAATCTGACGGTGCTCCAAGTGTGCAACTGGTTCATCAATGC
CCGTCGCCGCATTCTACCCGAGATGATCAGGCGCGAGGGCAACGATCCTC
TGCACTTCACCATATCGCGACGTGGCAAAAAGGTTAGCCCCAACTGTTCG
AGATCAAGTGCGTTGGGCGCAAACTTGACTGGGCCGAATCCCGCACACGG
AAGTCCTGCTTCCGAAGTGGTCGTTGGCGCTACAGAGGAGGTGGATGGCG
CCGGTGAGATTCACGAGGGCATCGCCAATGTGCTGACCAACTTTGAACAG
TATGTGCAGGGCCCCAACGGACAAATGGTCAAGATGGAGCCGGAGTACGA
GGACAGTGTCATCTACAGGTCCGAAGGCGAAGAGAGTGCACAGGGATACG
AGTCCTGTGGGCCGAACAGCGAGGAGGAAGTACGCTTCGAGACCTCCCAT
GATTGGCAGAGCGTTATAAAAACTGTATTTGGGACTGAGGAAGTCAGCAC
TTCGGCTGGCAATAATCCAGGTACCTCTGGTTCTAAGGCATCTGTTCAGA
ATACCGCCATCTGGAATCGCAATCAGACTGCGAAGCGTGACGTGAATCAA
CAGTTGACAGACTTTGAAAGCGAGCTGAATATAATACAGGCCTCAGAAAT
CCAGACAATCGATCCTACCAACTCCAATCAACAGGACATTGGTGACAATC
TACAGGCGGACGAGGTGTTTACCGGTGCCGAAGCAGAAGCTGGCCAGAGT
CAATTATCTGCTCTATCGCAGGGCACCAGTTCAGATGAGGAGGGCAAGTA
CAAGTGTCTCTATTATCTAGTGGAAACTGCCATGGCTGTGCGCCAAAACG
ATGACGTCCAGGATGACGATTTCGTTTACATGGGAGACGCAAGCTTTCTA
GACCAT

BO01121.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
vis-RA 1275 CG8821-PA 1..1272 17..1288 6360 100 Plus
achi-RA 1281 CG8819-PA 1..1278 17..1288 5680 96.5 Plus
achi-RD 1668 CG8819-PD 1..758 17..768 3260 95.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
vis-RA 1741 CG8821-RA 94..1365 17..1288 6360 100 Plus
achi-RA 2122 CG8819-RA 305..1582 17..1288 5680 96.5 Plus
achi-RD 2277 CG8819-RD 73..830 17..768 3260 95.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12509777..12510267 621..131 2455 100 Minus
2R 25286936 2R 12513566..12514062 621..131 2090 95.2 Minus
2R 25286936 2R 12508465..12508646 1173..992 910 100 Minus
2R 25286936 2R 12512254..12512435 1173..992 850 97.8 Minus
2R 25286936 2R 12509569..12509720 770..619 760 100 Minus
2R 25286936 2R 12513358..12513509 770..619 760 100 Minus
2R 25286936 2R 12508712..12508833 992..871 610 100 Minus
2R 25286936 2R 12508272..12508388 1288..1172 585 100 Minus
2R 25286936 2R 12510324..12510439 132..17 580 100 Minus
2R 25286936 2R 12512501..12512622 992..871 580 98.4 Minus
2R 25286936 2R 12508893..12508997 870..766 525 100 Minus
2R 25286936 2R 12512682..12512786 870..766 525 100 Minus
2R 25286936 2R 12512074..12512190 1288..1172 495 94.9 Minus
2R 25286936 2R 12514132..12514244 129..17 445 92.9 Minus
Blast to na_te.dros performed on 2014-11-27 01:08:02 has no hits.

BO01121.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:04 Download gff for BO01121.complete
Subject Subject Range Query Range Percent Splice Strand
vis-RA 1..1275 17..1289 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:56 Download gff for BO01121.complete
Subject Subject Range Query Range Percent Splice Strand
vis-RA 368..1645 17..1294 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:45:53 Download gff for BO01121.complete
Subject Subject Range Query Range Percent Splice Strand
vis-RA 177..1448 17..1290 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:04 Download gff for BO01121.complete
Subject Subject Range Query Range Percent Splice Strand
vis-RA 368..1645 17..1294 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:15 Download gff for BO01121.complete
Subject Subject Range Query Range Percent Splice Strand
vis-RA 94..1365 17..1290 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:15 Download gff for BO01121.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12510325..12510439 17..131 100   Minus
2R 12509779..12510266 132..619 100 <- Minus
2R 12509571..12509719 620..768 100 <- Minus
2R 12508893..12508994 769..870 100 <- Minus
2R 12508712..12508833 871..992 100 <- Minus
2R 12508466..12508645 993..1172 100 <- Minus
2R 12508270..12508387 1173..1290 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:45:53 Download gff for BO01121.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8397830..8397944 17..131 100   Minus
arm_2R 8397284..8397771 132..619 100 <- Minus
arm_2R 8397076..8397224 620..768 100 <- Minus
arm_2R 8396398..8396499 769..870 100 <- Minus
arm_2R 8396217..8396338 871..992 100 <- Minus
arm_2R 8395971..8396150 993..1172 100 <- Minus
arm_2R 8395775..8395892 1173..1290 98 <- Minus

BO01121.pep Sequence

Translation from 16 to 1306

> BO01121.pep
MISPEQEEVNMVLDRHVRQNIKDLMHEAHVHASLLNNEGRDRFHSDSSLD
QDSLHAVVGNDLSTEQGANQVQNYHDMMVDSEHHVDINGSLRKRRGNLPK
SSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRIL
PEMIRREGNDPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPASE
VVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSVIY
RSEGEESAQGYESCGPNSEEEVRFETSHDWQSVIKTVFGTEEVSTSAGNN
PGTSGSKASVQNTAIWNRNQTAKRDVNQQLTDFESELNIIQASEIQTIDP
TNSNQQDIGDNLQADEVFTGAEAEAGQSQLSALSQGTSSDEEGKYKCLYY
LVETAMAVRQNDDVQDDDFVYMGDASFLDH

BO01121.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
vis-PA 424 CG8821-PA 1..424 1..424 2209 100 Plus
achi-PA 426 CG8819-PA 1..426 1..424 2110 95.3 Plus
achi-PD 555 CG8819-PD 1..252 1..250 1243 94.4 Plus
achi-PC 555 CG8819-PC 1..252 1..250 1243 94.4 Plus
vis-PB 524 CG8821-PB 1..221 1..250 1121 88.4 Plus
achi-PD 555 CG8819-PD 370..555 244..424 868 92.5 Plus
achi-PC 555 CG8819-PC 370..555 244..424 868 92.5 Plus