Clone BO01124 Report

Search the DGRC for BO01124

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:24
Vector:pDNR-Dual
Associated Gene/Transcriptcad-RA
Protein status:BO01124.pep:
Sequenced Size:1315

Clone Sequence Records

BO01124.3prime Sequence

830 bp (731 high quality bases) assembled on 2005-11-30

> BO01124.3prime
ATGGTCTAGAAAGCTTGCCATCGAGAGCGTGCCCACTGCCGCCGCAGCGG
ACATCTGCGCACTGTGCTGCTGCTGCAGCTGGTGTGAGTGCGCCGCCACC
GCCGCCAAGGAGTGGCTGTGGGCGGCCAGGTGGGGATGCAGGCGCATGGC
GGGAATGTTCATCGCCGCCATGGGGTTCATCGAGTGGGCCAGCGAGTGGG
ACAGGTGCAGGCCCGGCTCCAGCTTCGCTTTGGCGTCCAGCAGCTGGCTG
TAGTCCGCATGCTGCACTCCCACGCCCATCACGTTCGGATCGCTACCCTT
CTTGTTCTGCTTGCGCTCCTTGGCGCGGCGGTTCTGGAACCAGATCTTAA
CCTGGCGCTCCGACAGCGACAGCGTCTGGGCGAGCTCGCTCTTCCGCCGG
ATGGTGATGTAGCGGGAGGTGCAGTACTCCTTCTCCAGCTCCAGGCGCTG
GAAGTCGGTGTACACCACGCGGTACTTATCCTTGGTGCGGGTTTTGCCTG
GTTGTGGTTGTGCTGGATAGGCGGGCTTCTTCATCCAGTCGAAGTATGGC
GGCTTCGATGGCGATGTCCTGTTGTTGTTGCTCACCGAATTGTTATTGTT
GTTGTTGTTATGGGTGGATGGGCTATTGTTGTTGTTGTTGTTGTTGTTGT
TGTTGTTGGCGACGGCACTCAAATGGTGTGCCAAGTGATGATGCGGCGAC
GAGGCAGAAGTCGGCGCCCCCGGGCTAGAGATTTTCGAGCCCGAAACGGT
AATCGGTGGCGACGGCAGACCTTCGGCGATGTGCTGCTGATGGTTGGGTG
GTGCGGAACCTGGTCCTCCATCGGTGGCCC

BO01124.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG1759-PA 1284 cad-RA 470..1281 830..19 4035 99.8 Minus
CG1759-PB 1284 cad-RB 470..1281 830..19 4035 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
cad-RB 2353 CG1759-RB 684..1495 830..19 4045 99.9 Minus
cad-RA 2516 CG1759-RA 847..1658 830..19 4045 99.9 Minus
cad-RC 2570 CG1759-RC 1233..1712 498..19 2400 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20781796..20782277 500..19 2410 100 Minus
2L 23513712 2L 20771577..20771910 830..497 1655 99.7 Minus
Blast to na_te.dros performed on 2015-02-11 15:32:06 has no hits.

BO01124.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:51 Download gff for BO01124.3prime
Subject Subject Range Query Range Percent Splice Strand
cad-PA 470..1284 16..830 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:20 Download gff for BO01124.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1759-PB 470..1284 16..830 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:47:11 Download gff for BO01124.3prime
Subject Subject Range Query Range Percent Splice Strand
cad-RA 847..1658 19..830 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:11:25 Download gff for BO01124.3prime
Subject Subject Range Query Range Percent Splice Strand
cad-RA 847..1658 19..830 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:11:25 Download gff for BO01124.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 20781799..20782277 19..497 100   Minus
2L 20771577..20771909 498..830 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:47:11 Download gff for BO01124.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20781799..20782277 19..497 100   Minus
arm_2L 20771577..20771909 498..830 99 -> Minus

BO01124.5prime Sequence

836 bp (760 high quality bases) assembled on 2005-11-30

> BO01124.5prime
GAAGTTATCAGTCGACATGGTTTCGCACTACTACAACACACTGCCCTACA
CACAAAAGCACAGTGCCGCCAATTTGGCCTATGCCTCAGCGGCGGGCCAG
CCATGGAACTGGACGCCCAACTACCACCACACGCCGCCGAACCACCAGTT
CCTGGGCGATGTGGACTCCTCGCATGCCGCCCACCACGCGGCCGCTGCCC
ACCAGATGTACTACAACTCCCATCACATGTTCCACTCGGCGGCGGCGGCC
TCTGCCGGGGAGTGGCACTCACCCGCCTCGAGCACGGCGGATAACTTCGT
TCAGAATGTGCCCACGTCGGCCCACCAGCTGATGCAGCAGCACCACCATC
ATCACGCCCATGCCTCCAGCAGTTCCGCCAGTTCCGGGAGCAGCAGTAGC
GGTGGTGCACCGGGTGCGCCCCAGCTCAACGAGACCAACAGCAGCATCGG
CGTCGGAGGAGCAGGCGGTGGCGGTGGTGTTGGCGGGGCCACCGATGGAG
GACCAGGTTCCGCACCACCCAACCATCAGCAGCACATCGCCGAAGGTCTG
CCGTCGCCACCGATTACCGTTTCGGGCTCGGAAATCTCTAGCCCGGGGGC
GCCGACTTCTGCCTCGTCGCCGCATCATCACTTGGCACACCATTTGAGTG
CCGTCGCCAACAACAACAACAACAACAACAACAACAACAATAGCCCATCC
ACCCATAACAACAACAACAATAACAATTCGGTGAGCAACAACAACAGGAC
ATCGCCATCGAAAGCGCCATACTTCGACTGGATGAAGAAGCCCGCCTATC
CAGCACAACCACAACCAGGCAAAACCCGCACCAAGG

BO01124.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG1759-PA 1284 cad-RA 1..820 17..836 4050 99.7 Plus
CG1759-PB 1284 cad-RB 1..820 17..836 4050 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
cad-RB 2353 CG1759-RB 215..1034 17..836 4070 99.8 Plus
cad-RA 2516 CG1759-RA 378..1197 17..836 4070 99.8 Plus
cad-RC 2570 CG1759-RC 378..1179 17..818 3980 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20771108..20771910 17..819 3985 99.8 Plus
Blast to na_te.dros performed 2015-02-11 02:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 5095..5139 20..64 117 73.3 Plus

BO01124.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:52 Download gff for BO01124.5prime
Subject Subject Range Query Range Percent Splice Strand
cad-PA 1..820 17..836 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:21 Download gff for BO01124.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1759-PB 1..820 17..836 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:42:53 Download gff for BO01124.5prime
Subject Subject Range Query Range Percent Splice Strand
cad-RA 373..1197 12..836 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:20:13 Download gff for BO01124.5prime
Subject Subject Range Query Range Percent Splice Strand
cad-RA 373..1197 12..836 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:20:13 Download gff for BO01124.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 20781799..20781816 819..836 100   Plus
2L 20771103..20771909 12..818 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:42:53 Download gff for BO01124.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20781799..20781816 819..836 100   Plus
arm_2L 20771103..20771909 12..818 99 -> Plus

BO01124.complete Sequence

1315 bp (1315 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629431

> BO01124.complete
GAAGTTATCAGTCGACATGGTTTCGCACTACTACAACACACTGCCCTACA
CACAAAAGCACAGTGCCGCCAATTTGGCCTATGCCTCAGCGGCGGGCCAG
CCATGGAACTGGACGCCCAACTACCACCACACGCCGCCGAACCACCAGTT
CCTGGGCGATGTGGACTCCTCGCATGCCGCCCACCACGCGGCCGCTGCCC
ACCAGATGTACTACAACTCCCATCACATGTTCCACTCGGCGGCGGCGGCC
TCTGCCGGGGAGTGGCACTCACCCGCCTCGAGCACGGCGGATAACTTCGT
TCAGAATGTGCCCACGTCGGCCCACCAGCTGATGCAGCAGCACCACCATC
ATCACGCCCATGCCTCCAGCAGTTCCGCCAGTTCCGGGAGCAGCAGTAGC
GGTGGTGCACCGGGTGCGCCCCAGCTCAACGAGACCAACAGCAGCATCGG
CGTCGGAGGAGCAGGCGGTGGCGGTGGTGTTGGCGGGGCCACCGATGGAG
GACCAGGTTCCGCACCACCCAACCATCAGCAGCACATCGCCGAAGGTCTG
CCGTCGCCACCGATTACCGTTTCGGGCTCGGAAATCTCTAGCCCGGGGGC
GCCGACTTCTGCCTCGTCGCCGCATCATCACTTGGCACACCATTTGAGTG
CCGTCGCCAACAACAACAACAACAACAACAACAACAACAATAGCCCATCC
ACCCATAACAACAACAACAATAACAATTCGGTGAGCAACAACAACAGGAC
ATCGCCATCGAAGCCGCCATACTTCGACTGGATGAAGAAGCCCGCCTATC
CAGCACAACCACAACCAGGCAAAACCCGCACCAAGGATAAGTACCGCGTG
GTGTACACCGACTTCCAGCGCCTGGAGCTGGAGAAGGAGTACTGCACCTC
CCGCTACATCACCATCCGGCGGAAGAGCGAGCTCGCCCAGACGCTGTCGC
TGTCGGAGCGCCAGGTTAAGATCTGGTTCCAGAACCGCCGCGCCAAGGAG
CGCAAGCAGAACAAGAAGGGTAGCGATCCGAACGTGATGGGCGTGGGAGT
GCAGCATGCGGACTACAGCCAGCTGCTGGACGCCAAAGCGAAGCTGGAGC
CGGGCCTGCACCTGTCCCACTCGCTGGCCCACTCGATGAACCCCATGGCG
GCGATGAACATTCCCGCCATGCGCCTGCATCCCCACCTGGCCGCCCACAG
CCACTCCTTGGCGGCGGTGGCGGCGCACTCACACCAGCTGCAGCAGCAGC
ACAGTGCGCAGATGTCCGCTGCGGCGGCAGTGGGCACGCTCTCGATGGCA
AGCTTTCTAGACCAT

BO01124.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
cad-RB 1284 CG1759-PB 1..1281 17..1297 6405 100 Plus
cad-RA 1284 CG1759-PA 1..1281 17..1297 6405 100 Plus
cad-RC 1338 CG1759-PC 1..802 17..818 4010 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
cad-RB 2353 CG1759-RB 215..1495 17..1297 6405 100 Plus
cad-RA 2516 CG1759-RA 378..1658 17..1297 6405 100 Plus
cad-RC 2570 CG1759-RC 378..1179 17..818 4010 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20771108..20771910 17..819 4015 100 Plus
2L 23513712 2L 20781796..20782277 816..1297 2410 100 Plus
Blast to na_te.dros performed 2014-11-28 08:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 5095..5139 20..64 117 73.3 Plus

BO01124.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:05 Download gff for BO01124.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RB 1..1284 17..1300 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:00:55 Download gff for BO01124.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RB 215..1495 17..1299 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:27 Download gff for BO01124.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RA 378..1658 17..1299 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:05 Download gff for BO01124.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RB 210..1495 12..1297 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:21:50 Download gff for BO01124.complete
Subject Subject Range Query Range Percent Splice Strand
cad-RA 378..1658 17..1299 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:21:50 Download gff for BO01124.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20781799..20782277 819..1299 99   Plus
2L 20771108..20771909 17..818 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:27 Download gff for BO01124.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20781799..20782277 819..1299 99   Plus
arm_2L 20771108..20771909 17..818 100 -> Plus

BO01124.pep Sequence

Translation from 16 to 1315

> BO01124.pep
MVSHYYNTLPYTQKHSAANLAYASAAGQPWNWTPNYHHTPPNHQFLGDVD
SSHAAHHAAAAHQMYYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVPT
SAHQLMQQHHHHHAHASSSSASSGSSSSGGAPGAPQLNETNSSIGVGGAG
GGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAPTSAS
SPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKP
PYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITI
RRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADY
SQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNIPAMRLHPHLAAHSHSLAA
VAAHSHQLQQQHSAQMSAAAAVGTLSMASFLDH

BO01124.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
cad-PB 427 CG1759-PB 1..427 1..427 2298 100 Plus
cad-PA 427 CG1759-PA 1..427 1..427 2298 100 Plus
cad-PC 445 CG1759-PC 1..445 1..427 2269 96 Plus
Scr-PB 417 CG1030-PB 78..387 58..336 266 28.2 Plus
Scr-PA 417 CG1030-PA 78..387 58..336 266 28.2 Plus