Clone BO01125 Report

Search the DGRC for BO01125

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:25
Vector:pDNR-Dual
Associated Gene/Transcripttth-RB
Protein status:BO01125.pep:
Sequenced Size:1318

Clone Sequence Records

BO01125.3prime Sequence

711 bp (623 high quality bases) assembled on 2005-11-30

> BO01125.3prime
ATGGTCTAGAAAGCTTGCCAGATACTTCCGATAGTTGCGCAGATGGGCGT
TCGCGTCCTCGACCACGCCCACCGCAGCAGCGGCACTCTCGAAGGATGGT
GGCTCGATGACCATGCCGGGACTTGTCGGATCGCATGACGCTCCAACGGC
GCTATTTGGCCCCTTGGCTCGTCGCCTGCCACGTGTTCCAGCTCCCCGCG
ATCTGCGGCTGTTGGCCGAAGCACCCGATGCTCCTCCTCCGCCGCCGGAT
CCCGAAACTCCCGCTAAGCCTGCTCCCAGGCTGCCGCTTAGGATGCCTCC
GCTGGAGATTGGTCCTCCATTGCTGCCTGGCACACTCTCGCCAGATTCAA
TGGCCTCCAGCGATGCGTCCAGCGCCGCATCCGTCGTTGTGATACGCGAC
CTGGCCGCTGCACTGCGTCTCCGCGAGCTGGAGCTACCGCCGGAATTGCC
GCCACCGCCGGCGCCTCCTCCACCACCACCGCCGCCGGAATCTCCACCTC
GCTTGCCTGGTCGCCGCTTGCGCCTTTTTTTGTTACCATAGCGCGGATCA
TAATCGTACTCATCATCCGCCGGCGATTTGGGCTCCTCCAGCGAGTCCAC
ATCGTTCATATCCATGTCATCGTAGAACCACTCCTTGGGCAAAAGCTCCT
CTTTGACGGCCTGCTGCTGGTGCTGGTGCTGCTGATGTTGTTGCTGTTGA
CTGTCCTTGCT

BO01125.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12175-PB 1287 tth-RB 592..1284 711..19 3390 99.5 Minus
CG3606-PB 1200 caz-RB 291..326 487..452 155 97.2 Minus
CG3606-PA 1200 caz-RA 291..326 487..452 155 97.2 Minus
CG32809-PD 3705 CG32809-RD 2479..2510 696..665 135 96.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
tth-RC 3138 CG12175-RC 1198..1890 711..19 3420 99.6 Minus
tth-RB 2955 CG12175-RB 1015..1707 711..19 3420 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13614441..13615133 19..711 3420 99.6 Plus
Blast to na_te.dros performed 2015-02-04 18:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2320..2369 711..661 162 82.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6743..6781 699..661 159 89.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6764..6802 699..661 159 89.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6785..6823 699..661 159 89.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6804..6856 711..661 152 79.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6760 699..661 150 87.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1531..1576 707..662 149 80.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2381..2422 704..662 149 86 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6822..6870 711..662 148 80 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2797..2849 711..661 143 79.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1527..1565 699..661 141 84.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6873..6971 711..612 137 61 Minus
roo 9092 roo DM_ROO 9092bp 1071..1108 698..661 136 84.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2397..2431 699..665 130 85.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2437..2476 701..662 128 80 Minus
roo 9092 roo DM_ROO 9092bp 1115..1152 699..662 127 81.6 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 155..193 699..661 123 79.5 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9185..9223 699..661 123 79.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2473..2521 711..662 121 74 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2626..2703 711..631 117 67.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2587..2639 711..661 116 74.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1506..1552 710..662 114 73.5 Minus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7964..7998 699..665 112 80 Minus
TART-C 11124 TART-C TARTC 11124bp 9408..9442 699..665 112 80 Minus

BO01125.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:53 Download gff for BO01125.3prime
Subject Subject Range Query Range Percent Splice Strand
tth-PB 592..1287 15..711 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:22 Download gff for BO01125.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12175-PB 592..1287 15..711 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:11:20 Download gff for BO01125.3prime
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1015..1710 15..711 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:26:19 Download gff for BO01125.3prime
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1015..1710 15..711 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:26:19 Download gff for BO01125.3prime
Subject Subject Range Query Range Percent Splice Strand
X 13614438..13615133 15..711 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:11:20 Download gff for BO01125.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 13508471..13509166 15..711 99   Plus

BO01125.5prime Sequence

678 bp (654 high quality bases) assembled on 2005-11-30

> BO01125.5prime
GAAGTTATCAGTCGACATGTCCTCCGCCGTTAACATCCAGATCGTCTCTA
TGCCGAATCTGGCCAAGATCGAGAGCTTCCTGAAGGATGTCAGCTACCGG
GAGACGATCGAGTACAGTGCCAACTTCAACACGCGCTTGTGCAGCGAACG
GCGCCACCGGCTGCCCTTCCTCGATCCGCAGACAGGCGTCGCCCAGAACC
ACTCGCAGCTCTTCCTGGACAAGCGACAGCGGATGCCCGGCTTCCGGCAG
GGCCAGATCTACACGTATCCGGCGGCCCGCTGGCGGAAGAGCCGTCGTCA
GTACTTGAGCAAGATGTACAGCCGCTTTCCCGAGCGTCCCTTCCAGGCGC
TACGCAAGGAGCACGAAGCTCTGGTGGCCAGCGGCGTCAATCTGGGACTG
AGCAGCCTGACCAGCGGTGTGGGCTCCATGCCCGGCAGCAATAGCCTGGC
CAGCAGCTCCTCCCTAACGCTCAATATGCTTACGGGCGGCGGAGCCGCGC
CGGCCGTACTTGGTTCCCTGCACAGTGACACTGCCCACGATTTTAATGGA
GCCTTCAGCCTGGAGGAGTCCAGCTCGCTGGGTGCCGCCGGCGGTGATAC
ATCCGACAGCAAGGACAGTCAACAGCAACAACATCAGCAGCACCAGCACC
AGCAGCAGGCCGTCAAAGAGGAGCTTTT

BO01125.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG12175-PB 1287 tth-RB 1..662 17..678 3285 99.8 Plus
CG32809-PD 3705 CG32809-RD 2479..2510 623..654 135 96.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
tth-RC 3138 CG12175-RC 606..1268 16..678 3300 99.8 Plus
tth-RB 2955 CG12175-RB 423..1085 16..678 3300 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13615063..13615424 678..317 1810 100 Minus
X 23542271 X 13615676..13615981 321..16 1515 99.7 Minus
Blast to na_te.dros performed on 2015-02-10 15:17:46 has no hits.

BO01125.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:54 Download gff for BO01125.5prime
Subject Subject Range Query Range Percent Splice Strand
tth-PB 1..662 17..678 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:24 Download gff for BO01125.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12175-PB 1..662 17..678 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:33:09 Download gff for BO01125.5prime
Subject Subject Range Query Range Percent Splice Strand
tth-RB 419..1085 9..678 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:13:58 Download gff for BO01125.5prime
Subject Subject Range Query Range Percent Splice Strand
tth-RB 419..1085 9..678 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:13:58 Download gff for BO01125.5prime
Subject Subject Range Query Range Percent Splice Strand
X 13615676..13615985 9..321 98   Minus
X 13615063..13615419 322..678 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:33:09 Download gff for BO01125.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 13509709..13510018 9..321 98   Minus
arm_X 13509096..13509452 322..678 100 <- Minus

BO01125.complete Sequence

1318 bp (1318 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629432

> BO01125.complete
GAAGTTATCAGTCGACATGTCCTCCGCCGTTAACATCCAGATCGTCTCTA
TGCCGAATCTGGCCAAGATCGAGAGCTTCCTGAAGGATGTCAGCTACCGG
GAGACGATCGAGTACAGTGCCAACTTCAACACGCGCTTGTGCAGCGAACG
GCGCCACCGGCTGCCCTTCCTCGATCCGCAGACAGGCGTCGCCCAGAACC
ACTCGCAGCTCTTCCTGGACAAGCGACAGCGGATGCCCGGCTTCCGGCAG
GGCCAGATCTACACGTATCCGGCGGCCCGCTGGCGGAAGAGCCGTCGTCA
GTACTTGAGCAAGATGTACAGCCGCTTTCCCGAGCGTCCCTTCCAGGCGC
TACGCAAGGAGCACGAAGCTCTGGTGGCCAGCGGCGTCAATCTGGGACTG
AGCAGCCTGACCAGCGGTGTGGGCTCCATGCCCGGCAGCAATAGCCTGGC
CAGCAGCTCCTCCCTAACGCTCAATATGCTTACGGGCGGCGGAGCCGCGC
CGGCCGTACTTGGTTCCCTGCACAGTGACACTGCCCACGATTTTAATGGA
GCCTTCAGCCTGGAGGAGTCCAGCTCGCTGGGTGCCGCCGGCGGTGATAC
ATCCGACAGCAAGGACAGTCAACAGCAACAACATCAGCAGCACCAGCACC
AGCAGCAGGCCGTCAAAGAGGAGCTTTTGCCCAAGGAGTGGTTCTACGAT
GACATGGATATGAACGATGTGGACTCGCTGGAGGAGCCCAAATCGCCGGC
GGATGATGAGTACGATTATGATCCGCGCTATGGTAACAAAAAAAGGCGCA
AGCGGCGACCAGGCAAGCGAGGTGGAGATTCCGGCGGCGGTGGTGGTGGA
GGAGGCGCCGGCGGTGGCGGCAATTCCGGCGGTAGCTCCAGCTCGCGGAG
ACGCAGTGCAGCGGCCAGGTCGCGTATCACAACGACGGATGCGGCGCTGG
ACGCATCGCTGGAGGCCATTGAATCTGGCGAGAGTGTGCCAGGCAGCAAT
GGAGGACCAATCTCCAGCGGAGGCATCCTAAGCGGCAGCCTGGGAGCAGG
CTTAGCGGGAGTTTCGGGATCCGGCGGCGGAGGAGGAGCATCGGGTGCTT
CGGCCAACAGCCGCAGATCGCGGGGAGCTGGAACACGTGGCAGGCGACGA
GCCAAGGGGCCAAATAGCGCCGTTGGAGCGTCATGCGATCCGACAAGTCC
CGGCATGGTCATCGAGCCACCATCCTTCGAGAGTGCCGCTGCTGCGGTGG
GCGTGGTCGAGGACGCGAACGCCCATCTGCGCAACTATCGGAAGTATCTG
GCAAGCTTTCTAGACCAT

BO01125.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
tth-RC 1287 CG12175-PC 1..1284 17..1300 6360 99.7 Plus
tth-RB 1287 CG12175-PB 1..1284 17..1300 6360 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
tth-RC 3138 CG12175-RC 606..1890 16..1300 6365 99.7 Plus
tth-RB 2955 CG12175-RB 423..1707 16..1300 6365 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13614441..13615424 1300..317 4875 99.7 Minus
X 23542271 X 13615676..13615981 321..16 1515 99.7 Minus
Blast to na_te.dros performed on 2014-11-27 20:17:55 has no hits.

BO01125.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:47:07 Download gff for BO01125.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1..1287 17..1304 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:18:00 Download gff for BO01125.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 370..1661 9..1304 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:08:24 Download gff for BO01125.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 424..1707 17..1302 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:47:07 Download gff for BO01125.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 370..1661 9..1304 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:18:52 Download gff for BO01125.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 424..1707 17..1302 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:18:52 Download gff for BO01125.complete
Subject Subject Range Query Range Percent Splice Strand
X 13615676..13615980 17..321 99   Minus
X 13614439..13615419 322..1302 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:08:24 Download gff for BO01125.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13509709..13510013 17..321 99   Minus
arm_X 13508472..13509452 322..1302 99 <- Minus

BO01125.pep Sequence

Translation from 16 to 1318

> BO01125.pep
MSSAVNIQIVSMPNLAKIESFLKDVSYRETIEYSANFNTRLCSERRHRLP
FLDPQTGVAQNHSQLFLDKRQRMPGFRQGQIYTYPAARWRKSRRQYLSKM
YSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGSMPGSNSLASSSSL
TLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDTSDSKD
SQQQQHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYD
YDPRYGNKKRRKRRPGKRGGDSGGGGGGGGAGGGGNSGGSSSSRRRSAAA
RSRITTTDAALDASLEAIESGESVPGSNGGPISSGGILSGSLGAGLAGVS
GSGGGGGASGASANSRRSRGAGTRGRRRAKGPNSAVGASCDPTSPGMVIE
PPSFESAAAAVGVVEDANAHLRNYRKYLASFLDH

BO01125.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
tth-PC 428 CG12175-PC 1..428 1..428 2201 100 Plus
tth-PB 428 CG12175-PB 1..428 1..428 2201 100 Plus
d4-PA 497 CG2682-PA 12..275 9..317 398 34.9 Plus
d4-PD 496 CG2682-PD 12..333 9..359 397 32.4 Plus
d4-PC 495 CG2682-PC 12..332 9..359 392 32 Plus