Clone BO01127 Report

Search the DGRC for BO01127

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:11
Well:27
Vector:pDNR-Dual
Associated Gene/Transcriptkni-RA
Protein status:BO01127.pep:
Sequenced Size:1321

Clone Sequence Records

BO01127.3prime Sequence

850 bp (715 high quality bases) assembled on 2005-11-30

> BO01127.3prime
ATGGTCTAGAAAGCTTGCGACACACACGAATATTCCCCTCATGGCACTAG
CCGCATTGTGGGCCACCGCGAAGCCACCGAAGTGGGTGGCCTCTGCACCA
CCTAGCTTCTGCCGCTTGACTTCCGCATGGGCGGTGGTGGTGTTCGGTGA
GTGGGCGGCGGAGTGGGAGGAACTGCTGCTGCTGGTGGTCAGGCACTCGG
CCTCCAGTTGGTAGAACTTCCGGCGCGGAGCCACCTCCACTTCTTGATCC
TCGGAGCCGCTGTCGTTGAAGCTGTGCACGGAGCTCCGCGAGGTCTTCAT
GCTCAGATCCATGGGTCCTTCTTGAGCGGAAACGGTGGGAGGATGCACTG
GTACAACGCTGGTGGTTTCGCCGCCAATGGAGCAAACCGAAACGGGCGAC
AAGCTCTGCATCTTGGCCGCAAAACTCAGCGGGCTGCTGCTAGTCGGAGT
GGTTGGCGTGGCTCGGATGGCAATGGGATGCAGGAGGCTTGCGGACGACT
GATGGCTGTGCACGGAGTGAACATCCTCCTCCAGGCAGACATCGATGGGC
GACTGGCGGGCCGAGGAGGTGGGCTGCACCACTGGTGGCTGGCTGGCGGG
ACTAAAGCGGTTCTGCGACTCAACGGAATCCACGCTCTGGCGGTGCTTGT
ACATCTCCTGCCGGTAAGCGGCATCGGCAGCAGAAGCCGCTGCAGCGGCA
GCACTTGCATGGTAGCCTGGGAAGAGGAGGTGTGGGGGCAGCTGGAAGGG
CGACTGGTGCGGTACACCGCCCATCATGCTGAAGAAGGGCAGGGCGGCGG
ATGGGTCGGACAGATAGCTGGGATAGCCCAGCAGAGGCATATGTGGATGA

BO01127.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG4717-PA 1290 kni-RA 456..1287 850..19 4160 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
kni-RB 1911 CG4717-RB 571..1402 850..19 4160 100 Minus
kni-RA 2100 CG4717-RA 760..1591 850..19 4160 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20692839..20693670 19..850 4160 100 Plus
Blast to na_te.dros performed 2015-02-13 13:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 596..728 799..672 113 60.6 Minus

BO01127.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:57 Download gff for BO01127.3prime
Subject Subject Range Query Range Percent Splice Strand
kni-PA 457..1290 15..849 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:28 Download gff for BO01127.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4717-PA 457..1290 15..849 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:33:19 Download gff for BO01127.3prime
Subject Subject Range Query Range Percent Splice Strand
kni-RA 761..1595 14..849 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:37:42 Download gff for BO01127.3prime
Subject Subject Range Query Range Percent Splice Strand
kni-RA 761..1595 14..849 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:37:42 Download gff for BO01127.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 20692835..20693669 14..849 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:33:19 Download gff for BO01127.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20685935..20686769 14..849 99   Plus

BO01127.5prime Sequence

852 bp (791 high quality bases) assembled on 2005-11-30

> BO01127.5prime
GAAGTTATCAGTCGACATGAACCAGACATGCAAAGTGTGCGGTGAGCCGG
CGGCGGGCTTCCATTTTGGCGCCTTCACCTGCGAGGGCTGCAAGTCCTTC
TTTGGCCGCTCTTACAACAACATCAGCACCATCAGCGAGTGCAAGAACGA
GGGCAAGTGCATCATCGACAAGAAGAACCGCACCACCTGCAAGGCGTGCC
GCTTGAGGAAGTGCTACAACGTGGGCATGTCGAAGGGGGGATCCCGCTAC
GGACGTCGCTCCAACTGGTTCAAGATCCATTGTCTGCTGCAGGAGCACGA
ACAGGCCGCCGCAGCGGCGGGCAAGGCGCCTCCATTAGCGGGTGGCGTAT
CGGTGGGTGGTGCCCCGTCGGCCTCTTCCCCGGTGGGCTCGCCACACACT
CCCGGATTTGGGGACATGGCCGCCCATTTGCACCACCATCATCAGCAGCA
GCAGCAGCAGCAGGTGCCGCGTCATCCACATATGCCTCTGCTGGGCTATC
CCAGCTATCTGTCCGACCCATCCGCCGCCCTGCCCTTCTTCAGCATGATG
GGCGGTGTACCGCACCAGTCGCCCTTCCAGCTGCCCCCACACCTCCTCTT
CCCAGGCTACCATGCAAGTGCTGCCGCTGCAGCGGCTTCTGCTGCCGATG
CCGCTTACCGGCAGGAGATGTACAAGCACCGCCAGAGCGTGGATTCCGTT
GAGTCGCAGAACCGCTTTAGTCCCGCCAGCCAGCCACCAGTGGTGCAGCC
CACCTCCTCGGCCCGCCAGTCGCCCATCGATGTCTGCCTGGAGGAGGATG
TTCACTCCGTGCACAGCCATCAGTCGTCCGCCAGCCTCCTGCATCCCATT
GC

BO01127.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG4717-PA 1290 kni-RA 1..836 17..852 4155 99.8 Plus
CG4761-PA 1944 knrl-RA 232..308 221..297 235 92.2 Plus
CG7383-PB 1122 eg-RB 226..281 242..297 180 92.8 Plus
CG7383-PA 1122 eg-RA 226..281 242..297 180 92.8 Plus
CG4761-PA 1944 knrl-RA 28..131 17..120 170 86.5 Plus
CG4761-PA 1944 knrl-RA 151..212 140..201 160 90.3 Plus
CG32689-PA 366 CG32689-RA 64..96 431..463 140 96.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
kni-RB 1911 CG4717-RB 116..951 17..852 4165 99.9 Plus
kni-RA 2100 CG4717-RA 305..1140 17..852 4165 99.9 Plus
knrl-RB 2925 CG4761-RB 992..1272 17..297 730 84 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20693290..20694049 852..93 3785 99.9 Minus
3L 28110227 3L 20599778..20599982 297..93 515 83.4 Minus
3L 28110227 3L 20694263..20694340 94..17 390 100 Minus
3L 28110227 3L 21816347..21816480 164..297 355 84.3 Plus
3L 28110227 3L 20602193..20602270 94..17 225 85.9 Minus
3L 28110227 3L 21814779..21814856 17..94 195 83.3 Plus
Blast to na_te.dros performed 2015-02-12 05:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2443..2519 113..192 150 67.5 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 596..728 523..650 113 60.6 Plus

BO01127.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:23:57 Download gff for BO01127.5prime
Subject Subject Range Query Range Percent Splice Strand
kni-PA 1..836 17..852 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:18:30 Download gff for BO01127.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4717-PA 1..836 17..852 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:17:18 Download gff for BO01127.5prime
Subject Subject Range Query Range Percent Splice Strand
kni-RA 305..1140 17..852 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:45:41 Download gff for BO01127.5prime
Subject Subject Range Query Range Percent Splice Strand
kni-RA 305..1140 17..852 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:45:41 Download gff for BO01127.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 20694263..20694349 7..94 95   Minus
3L 20693290..20694047 95..852 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:17:18 Download gff for BO01127.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20687363..20687449 7..94 95   Minus
arm_3L 20686390..20687147 95..852 99 <- Minus

BO01127.complete Sequence

1321 bp (1321 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629433

> BO01127.complete
GAAGTTATCAGTCGACATGAACCAGACATGCAAAGTGTGCGGTGAGCCGG
CGGCGGGCTTCCATTTTGGCGCCTTCACCTGCGAGGGCTGCAAGTCCTTC
TTTGGCCGCTCTTACAACAACATCAGCACCATCAGCGAGTGCAAGAACGA
GGGCAAGTGCATCATCGACAAGAAGAACCGCACCACCTGCAAGGCGTGCC
GCTTGAGGAAGTGCTACAACGTGGGCATGTCGAAGGGGGGATCCCGCTAC
GGACGTCGCTCCAACTGGTTCAAGATCCATTGTCTGCTGCAGGAGCACGA
ACAGGCCGCCGCAGCGGCGGGCAAGGCGCCTCCATTAGCGGGTGGCGTAT
CGGTGGGTGGTGCCCCGTCGGCCTCTTCCCCGGTGGGCTCGCCACACACT
CCCGGATTTGGGGACATGGCCGCCCATTTGCACCACCATCATCAGCAGCA
GCAGCAGCAGCAGGTGCCGCGTCATCCACATATGCCTCTGCTGGGCTATC
CCAGCTATCTGTCCGACCCATCCGCCGCCCTGCCCTTCTTCAGCATGATG
GGCGGTGTACCGCACCAGTCGCCCTTCCAGCTGCCCCCACACCTCCTCTT
CCCAGGCTACCATGCAAGTGCTGCCGCTGCAGCGGCTTCTGCTGCCGATG
CCGCTTACCGGCAGGAGATGTACAAGCACCGCCAGAGCGTGGATTCCGTT
GAGTCGCAGAACCGCTTTAGTCCCGCCAGCCAGCCACCAGTGGTGCAGCC
CACCTCCTCGGCCCGCCAGTCGCCCATCGATGTCTGCCTGGAGGAGGATG
TTCACTCCGTGCACAGCCATCAGTCGTCCGCAAGCCTCCTGCATCCCATT
GCCATCCGAGCCACGCCAACCACTCCGACTAGCAGCAGCCCGCTGAGTTT
TGCGGCCAAGATGCAGAGCTTGTCGCCCGTTTCGGTTTGCTCCATTGGCG
GCGAAACCACCAGCGTTGTACCAGTGCATCCTCCCACCGTTTCCGCTCAA
GAAGGACCCATGGATCTGAGCATGAAGACCTCGCGGAGCTCCGTGCACAG
CTTCAACGACAGCGGCTCCGAGGATCAAGAAGTGGAGGTGGCTCCGCGCC
GGAAGTTCTACCAACTGGAGGCCGAGTGCCTGACCACCAGCAGCAGCAGT
TCCTCCCACTCCGCCGCCCACTCACCGAACACCACCACCGCCCATGCGGA
AGTCAAGCGGCAGAAGCTAGGTGGTGCAGAGGCCACCCACTTCGGTGGCT
TCGCGGTGGCCCACAATGCGGCTAGTGCCATGAGGGGAATATTCGTGTGT
GTCGCAAGCTTTCTAGACCAT

BO01127.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
kni-RB 1305 CG4717-PB 16..1302 17..1303 6435 100 Plus
kni-RA 1290 CG4717-PA 1..1287 17..1303 6435 100 Plus
knrl-RB 1944 CG4761-PB 28..308 17..297 730 84 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
kni-RB 1911 CG4717-RB 116..1402 17..1303 6435 100 Plus
kni-RA 2100 CG4717-RA 305..1591 17..1303 6435 100 Plus
knrl-RB 2925 CG4761-RB 992..1272 17..297 730 84 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20692839..20694049 1303..93 6055 100 Minus
3L 28110227 3L 20599778..20599982 297..93 515 83.4 Minus
3L 28110227 3L 20694263..20694340 94..17 390 100 Minus
3L 28110227 3L 21816347..21816480 164..297 355 84.3 Plus
3L 28110227 3L 20602193..20602270 94..17 225 85.9 Minus
3L 28110227 3L 21814779..21814856 17..94 195 83.3 Plus
Blast to na_te.dros performed 2014-11-27 07:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2443..2519 113..192 150 67.5 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 596..728 523..650 113 60.6 Plus

BO01127.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:55 Download gff for BO01127.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 1..1290 17..1307 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:43 Download gff for BO01127.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 290..1580 17..1308 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:23:12 Download gff for BO01127.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 305..1591 17..1305 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:55 Download gff for BO01127.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 290..1580 17..1308 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:17:18 Download gff for BO01127.complete
Subject Subject Range Query Range Percent Splice Strand
kni-RA 305..1591 17..1305 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:17:18 Download gff for BO01127.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20694263..20694340 17..94 100   Minus
3L 20692837..20694047 95..1305 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:23:12 Download gff for BO01127.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20687363..20687440 17..94 100   Minus
arm_3L 20685937..20687147 95..1305 99 <- Minus

BO01127.pep Sequence

Translation from 16 to 1321

> BO01127.pep
MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCII
DKKNRTTCKACRLRKCYNVGMSKGGSRYGRRSNWFKIHCLLQEHEQAAAA
AGKAPPLAGGVSVGGAPSASSPVGSPHTPGFGDMAAHLHHHHQQQQQQQV
PRHPHMPLLGYPSYLSDPSAALPFFSMMGGVPHQSPFQLPPHLLFPGYHA
SAAAAAASAADAAYRQEMYKHRQSVDSVESQNRFSPASQPPVVQPTSSAR
QSPIDVCLEEDVHSVHSHQSSASLLHPIAIRATPTTPTSSSPLSFAAKMQ
SLSPVSVCSIGGETTSVVPVHPPTVSAQEGPMDLSMKTSRSSVHSFNDSG
SEDQEVEVAPRRKFYQLEAECLTTSSSSSSHSAAHSPNTTTAHAEVKRQK
LGGAEATHFGGFAVAHNAASAMRGIFVCVASFLDH

BO01127.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
kni-PB 434 CG4717-PB 6..434 1..429 2276 100 Plus
kni-PA 429 CG4717-PA 1..429 1..429 2276 100 Plus
knrl-PB 647 CG4761-PB 10..128 1..116 503 78.2 Plus
knrl-PA 647 CG4761-PA 10..128 1..116 503 78.2 Plus
eg-PA 373 CG7383-PA 1..118 1..120 470 71.7 Plus